BLASTX nr result
ID: Bupleurum21_contig00006586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00006586 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABC01902.1| putative 60S ribosomal protein L7-like protein [S... 64 2e-08 >gb|ABC01902.1| putative 60S ribosomal protein L7-like protein [Solanum tuberosum] Length = 246 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 LNKPEKALHGKKKRFSDGGDSGNRETLINELISKMN 110 L KPEKAL GKKKR++DGGDSGNRE INELISKMN Sbjct: 211 LTKPEKALQGKKKRYNDGGDSGNREDHINELISKMN 246