BLASTX nr result
ID: Bupleurum21_contig00006516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00006516 (367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306868.1| predicted protein [Populus trichocarpa] gi|2... 71 8e-11 ref|XP_002529839.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 ref|XP_004149332.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ... 62 4e-08 ref|NP_179634.2| RabGAP/TBC domain-containing protein [Arabidops... 61 8e-08 ref|XP_002886279.1| RabGAP/TBC domain-containing protein [Arabid... 61 8e-08 >ref|XP_002306868.1| predicted protein [Populus trichocarpa] gi|222856317|gb|EEE93864.1| predicted protein [Populus trichocarpa] Length = 418 Score = 71.2 bits (173), Expect = 8e-11 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 240 RTSDEDLDKYFPIRPECQADVPKPRFKLRIGRTLSERRWNAA 365 RT EDL ++PIRP+CQAD PKPRFK R G+TLSERRWNAA Sbjct: 3 RTGAEDLGDFYPIRPDCQADTPKPRFKPRAGKTLSERRWNAA 44 >ref|XP_002529839.1| conserved hypothetical protein [Ricinus communis] gi|223530667|gb|EEF32540.1| conserved hypothetical protein [Ricinus communis] Length = 421 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +3 Query: 252 EDLDKYFPIRPECQADVPKPRFKLRIGRTLSERRWNAA 365 +D+ ++PIRPECQAD PKPRFK R G+TLS RRW+AA Sbjct: 15 DDIGTFYPIRPECQADAPKPRFKPRAGKTLSSRRWHAA 52 >ref|XP_004149332.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 15-like [Cucumis sativus] Length = 418 Score = 62.4 bits (150), Expect = 4e-08 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +3 Query: 255 DLDKYFPIRPECQADVPKPRFKLRIGRTLSERRWNAA 365 +LD ++PIRPECQAD+PK RFK++ G+TLS RRW+AA Sbjct: 9 ELDAFYPIRPECQADIPKTRFKIKPGKTLSARRWDAA 45 >ref|NP_179634.2| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] gi|238479300|ref|NP_001154525.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] gi|330251913|gb|AEC07007.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] gi|330251914|gb|AEC07008.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana] Length = 425 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +3 Query: 240 RTSDEDLDKYFPIRPECQADVPKPRFKLRIGRTLSERRWNAA 365 ++ EDL ++P+RPECQ DVP+ RFK R G+TLS RRW+AA Sbjct: 9 KSGGEDLQGFYPVRPECQPDVPRTRFKSRAGKTLSARRWHAA 50 >ref|XP_002886279.1| RabGAP/TBC domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297332119|gb|EFH62538.1| RabGAP/TBC domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 425 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +3 Query: 240 RTSDEDLDKYFPIRPECQADVPKPRFKLRIGRTLSERRWNAA 365 ++ EDL ++P+RPECQ DVP+ RFK R G+TLS RRW+AA Sbjct: 9 KSGGEDLQGFYPVRPECQPDVPRTRFKSRAGKTLSARRWHAA 50