BLASTX nr result
ID: Bupleurum21_contig00006455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00006455 (383 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77841.1| hypothetical protein VITISV_015562 [Vitis vinifera] 59 5e-07 >emb|CAN77841.1| hypothetical protein VITISV_015562 [Vitis vinifera] Length = 383 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/52 (61%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -2 Query: 310 GFRRAQSEGNLEGLAKAS-NDIDEFNFSNPIKKFASRCSSSLLETIPSFSFH 158 GFRRAQS+GNL+GLA AS N+ DE + N KK + R S S+L+TIPSFSF+ Sbjct: 134 GFRRAQSDGNLKGLAYASCNNNDELSTPNLSKKSSQRPSRSMLQTIPSFSFY 185