BLASTX nr result
ID: Bupleurum21_contig00006261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00006261 (494 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI18037.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002271567.1| PREDICTED: probable receptor-like protein ki... 65 7e-09 ref|XP_003623620.1| Protein kinase 2A [Medicago truncatula] gi|3... 61 1e-07 ref|XP_003604788.1| Protein kinase 2A [Medicago truncatula] gi|3... 60 1e-07 ref|XP_002528686.1| protein kinase atsik, putative [Ricinus comm... 60 2e-07 >emb|CBI18037.3| unnamed protein product [Vitis vinifera] Length = 660 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -1 Query: 152 ELKMGCFKVLKGKKKSSEQNKSVKRVNPQDHPPTALPEPPTHSR-LQSAPP 3 E KMGCFKVLK KKK +E+ +KR+NPQ+ PT LPEP SR LQSAPP Sbjct: 110 EDKMGCFKVLKSKKKKAERTAYIKRINPQELTPTTLPEPKLQSRTLQSAPP 160 >ref|XP_002271567.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Vitis vinifera] Length = 548 Score = 64.7 bits (156), Expect = 7e-09 Identities = 31/48 (64%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = -1 Query: 143 MGCFKVLKGKKKSSEQNKSVKRVNPQDHPPTALPEPPTHSR-LQSAPP 3 MGCFKVLK KKK +E+ +KR+NPQ+ PT LPEP SR LQSAPP Sbjct: 1 MGCFKVLKSKKKKAERTAYIKRINPQELTPTTLPEPKLQSRTLQSAPP 48 >ref|XP_003623620.1| Protein kinase 2A [Medicago truncatula] gi|355498635|gb|AES79838.1| Protein kinase 2A [Medicago truncatula] Length = 546 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = -1 Query: 143 MGCFKVLKGKKKSSEQNKSVKRVNPQDHPPTALPEPPTHSR-LQSAPP 3 MGCF VLK KKK S+ VKR++ +H P+ LPEP TH+R LQSAPP Sbjct: 1 MGCFTVLKSKKKKSDSFAYVKRISHNEHAPSVLPEPQTHTRSLQSAPP 48 >ref|XP_003604788.1| Protein kinase 2A [Medicago truncatula] gi|355505843|gb|AES86985.1| Protein kinase 2A [Medicago truncatula] Length = 542 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/48 (62%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = -1 Query: 143 MGCFKVLKGKKKSSEQNKSVKRVNPQDHPPTALPEPPTHSR-LQSAPP 3 MGCF +LK KKK +Q VKRV+P + PT LPEP TH+R LQSAPP Sbjct: 1 MGCFTILKRKKKKPDQIVYVKRVSPGEDSPTVLPEPQTHTRSLQSAPP 48 >ref|XP_002528686.1| protein kinase atsik, putative [Ricinus communis] gi|223531858|gb|EEF33675.1| protein kinase atsik, putative [Ricinus communis] Length = 543 Score = 59.7 bits (143), Expect = 2e-07 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 2/49 (4%) Frame = -1 Query: 143 MGCFKVLKGKKKSSEQNKSVKRVNPQDHPPTALPEP--PTHSRLQSAPP 3 MGCF VLK KKK E + S+KRV+P++ PT LPEP PT S LQSAPP Sbjct: 1 MGCFTVLKSKKKKPEPSVSIKRVSPKEQTPTTLPEPQIPTRS-LQSAPP 48