BLASTX nr result
ID: Bupleurum21_contig00006216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00006216 (585 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG51325.1|AC020580_5 poly(A) polymerase, putative; 41591-393... 55 7e-06 ref|NP_187308.3| poly(A) polymerase 3 [Arabidopsis thaliana] gi|... 55 7e-06 gb|AAP86215.1| poly(A) polymerase [Arabidopsis thaliana] 55 7e-06 >gb|AAG51325.1|AC020580_5 poly(A) polymerase, putative; 41591-39333 [Arabidopsis thaliana] Length = 482 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 6/64 (9%) Frame = -3 Query: 583 EKAKRDWVVSELEKIVRRWVRN----HTKAKHP--HTVATVLPFGSHGLDVHTSDSDINV 422 ++ KR V+++L KIV RWV+N H ++ T AT+LP+GS+GL V+ S+SDI+ Sbjct: 12 DEVKRRGVINQLRKIVVRWVKNVAWQHRLPQNQIDATNATILPYGSYGLGVYGSESDIDA 71 Query: 421 LCVG 410 LC+G Sbjct: 72 LCIG 75 >ref|NP_187308.3| poly(A) polymerase 3 [Arabidopsis thaliana] gi|62320636|dbj|BAD95301.1| poly(A) polymerase [Arabidopsis thaliana] gi|332640894|gb|AEE74415.1| poly(A) polymerase 3 [Arabidopsis thaliana] Length = 507 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 6/64 (9%) Frame = -3 Query: 583 EKAKRDWVVSELEKIVRRWVRN----HTKAKHP--HTVATVLPFGSHGLDVHTSDSDINV 422 ++ KR V+++L KIV RWV+N H ++ T AT+LP+GS+GL V+ S+SDI+ Sbjct: 36 DEVKRRGVINQLRKIVVRWVKNVAWQHRLPQNQIDATNATILPYGSYGLGVYGSESDIDA 95 Query: 421 LCVG 410 LC+G Sbjct: 96 LCIG 99 >gb|AAP86215.1| poly(A) polymerase [Arabidopsis thaliana] Length = 483 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 6/64 (9%) Frame = -3 Query: 583 EKAKRDWVVSELEKIVRRWVRN----HTKAKHP--HTVATVLPFGSHGLDVHTSDSDINV 422 ++ KR V+++L KIV RWV+N H ++ T AT+LP+GS+GL V+ S+SDI+ Sbjct: 12 DEVKRRGVINQLRKIVVRWVKNVAWQHRLPQNQIDATNATILPYGSYGLGVYGSESDIDA 71 Query: 421 LCVG 410 LC+G Sbjct: 72 LCIG 75