BLASTX nr result
ID: Bupleurum21_contig00004790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00004790 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004167690.1| PREDICTED: citrate synthase, glyoxysomal-lik... 63 3e-08 ref|XP_004143228.1| PREDICTED: citrate synthase, glyoxysomal-lik... 63 3e-08 sp|P49299.1|CYSZ_CUCMA RecName: Full=Citrate synthase, glyoxysom... 62 5e-08 ref|XP_002284064.1| PREDICTED: citrate synthase, glyoxysomal [Vi... 61 8e-08 emb|CAN62289.1| hypothetical protein VITISV_017314 [Vitis vinifera] 61 8e-08 >ref|XP_004167690.1| PREDICTED: citrate synthase, glyoxysomal-like [Cucumis sativus] Length = 512 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/37 (70%), Positives = 36/37 (97%) Frame = -1 Query: 364 WLRPYMPPRERMVPSESDKLGQVSVSNATRRRLAGSG 254 WLR Y+PP+ER+VP+++D+LGQVSVSNA++RRL+GSG Sbjct: 475 WLRHYIPPKERLVPAKADRLGQVSVSNASKRRLSGSG 511 >ref|XP_004143228.1| PREDICTED: citrate synthase, glyoxysomal-like [Cucumis sativus] Length = 612 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/37 (70%), Positives = 36/37 (97%) Frame = -1 Query: 364 WLRPYMPPRERMVPSESDKLGQVSVSNATRRRLAGSG 254 WLR Y+PP+ER+VP+++D+LGQVSVSNA++RRL+GSG Sbjct: 575 WLRHYIPPKERLVPAKADRLGQVSVSNASKRRLSGSG 611 >sp|P49299.1|CYSZ_CUCMA RecName: Full=Citrate synthase, glyoxysomal; AltName: Full=GCS; Flags: Precursor gi|1084323|pir||S53007 citrate synthase - cucurbit gi|975633|dbj|BAA07328.1| glyoxysomal citrate synthase [Cucurbita cv. Kurokawa Amakuri] Length = 516 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/37 (70%), Positives = 35/37 (94%) Frame = -1 Query: 364 WLRPYMPPRERMVPSESDKLGQVSVSNATRRRLAGSG 254 WLR Y+PP ER+VP+++D+LGQVSVSNA++RRL+GSG Sbjct: 479 WLRHYIPPNERLVPAKADRLGQVSVSNASKRRLSGSG 515 >ref|XP_002284064.1| PREDICTED: citrate synthase, glyoxysomal [Vitis vinifera] gi|296086334|emb|CBI31775.3| unnamed protein product [Vitis vinifera] Length = 512 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = -1 Query: 364 WLRPYMPPRERMVPSESDKLGQVSVSNATRRRLAGSG 254 WLR +MP +ERM+ +E+D+LGQVS+SNATRRRLAGSG Sbjct: 475 WLRHFMPVKERMMSAEADRLGQVSISNATRRRLAGSG 511 >emb|CAN62289.1| hypothetical protein VITISV_017314 [Vitis vinifera] Length = 103 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = -1 Query: 364 WLRPYMPPRERMVPSESDKLGQVSVSNATRRRLAGSG 254 WLR +MP +ERM+ +E+D+LGQVS+SNATRRRLAGSG Sbjct: 66 WLRHFMPVKERMMSAEADRLGQVSISNATRRRLAGSG 102