BLASTX nr result
ID: Bupleurum21_contig00004624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00004624 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631485.1| PREDICTED: protein Dom3z homolog, chloroplas... 70 1e-10 emb|CBI33986.3| unnamed protein product [Vitis vinifera] 70 1e-10 ref|XP_003539119.1| PREDICTED: protein Dom3z homolog, chloroplas... 68 7e-10 ref|XP_003539118.1| PREDICTED: protein Dom3z homolog, chloroplas... 68 7e-10 ref|XP_003611401.1| Dom3z-like protein [Medicago truncatula] gi|... 68 7e-10 >ref|XP_003631485.1| PREDICTED: protein Dom3z homolog, chloroplastic-like [Vitis vinifera] Length = 424 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +1 Query: 145 DDDDKDLFGSDNEDYCKTLAASPFPVPVLPVVRNTSNHVR 264 D D+KDLFGSDNEDYCKTLA SP+PVPVLP +RN +N R Sbjct: 84 DSDEKDLFGSDNEDYCKTLAISPYPVPVLPAIRNNNNQNR 123 >emb|CBI33986.3| unnamed protein product [Vitis vinifera] Length = 447 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +1 Query: 145 DDDDKDLFGSDNEDYCKTLAASPFPVPVLPVVRNTSNHVR 264 D D+KDLFGSDNEDYCKTLA SP+PVPVLP +RN +N R Sbjct: 84 DSDEKDLFGSDNEDYCKTLAISPYPVPVLPAIRNNNNQNR 123 >ref|XP_003539119.1| PREDICTED: protein Dom3z homolog, chloroplastic-like isoform 2 [Glycine max] Length = 499 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +1 Query: 145 DDDDKDLFGSDNEDYCKTLAASPFPVPVLPVVRNTSNHVR 264 D +DKDLFGSDNEDYCKTLA SP+P+PVLP +RN N R Sbjct: 88 DYEDKDLFGSDNEDYCKTLARSPYPIPVLPAIRNVHNQGR 127 >ref|XP_003539118.1| PREDICTED: protein Dom3z homolog, chloroplastic-like isoform 1 [Glycine max] Length = 507 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +1 Query: 145 DDDDKDLFGSDNEDYCKTLAASPFPVPVLPVVRNTSNHVR 264 D +DKDLFGSDNEDYCKTLA SP+P+PVLP +RN N R Sbjct: 88 DYEDKDLFGSDNEDYCKTLARSPYPIPVLPAIRNVHNQGR 127 >ref|XP_003611401.1| Dom3z-like protein [Medicago truncatula] gi|355512736|gb|AES94359.1| Dom3z-like protein [Medicago truncatula] Length = 517 Score = 68.2 bits (165), Expect = 7e-10 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +1 Query: 142 EDDDDKDLFGSDNEDYCKTLAASPFPVPVLPVVRNTSNH 258 +D DD+DLFG DNEDYCKTLA SP+P+PVLP +RN +N+ Sbjct: 87 DDHDDRDLFGDDNEDYCKTLAKSPYPIPVLPPIRNNTNN 125