BLASTX nr result
ID: Bupleurum21_contig00003989
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00003989 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007155703.1| NADP-dependent oxidoreductase domain protein... 60 2e-07 ref|XP_003629903.1| Oxidoreductase Tas aldo/keto reductase famil... 59 4e-07 ref|ZP_05926507.1| oxidoreductase Tas aldo/keto reductase family... 57 2e-06 ref|YP_007147500.1| putative oxidoreductase, aryl-alcohol dehydr... 56 3e-06 ref|YP_007052947.1| aldo/keto reductase [Nostoc sp. PCC 7107] gi... 56 3e-06 >ref|YP_007155703.1| NADP-dependent oxidoreductase domain protein [Anabaena cylindrica PCC 7122] gi|428678027|gb|AFZ56793.1| NADP-dependent oxidoreductase domain protein [Anabaena cylindrica PCC 7122] Length = 346 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 3 TQAIDNSLLRLQTDYIDLYQIHWPDRRPPTLIQT 104 TQA+D+SL RLQTDYIDLYQIHWPDR PT QT Sbjct: 110 TQAVDDSLQRLQTDYIDLYQIHWPDRYVPTFGQT 143 >ref|XP_003629903.1| Oxidoreductase Tas aldo/keto reductase family [Medicago truncatula] gi|355523925|gb|AET04379.1| Oxidoreductase Tas aldo/keto reductase family [Medicago truncatula] Length = 407 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +3 Query: 3 TQAIDNSLLRLQTDYIDLYQIHWPDRRPPTLIQTLIRHLQSLSSL 137 +QAIDNSLLR+Q DYIDLYQIHWPDR P +T +Q SS+ Sbjct: 150 SQAIDNSLLRMQLDYIDLYQIHWPDRYVPMFGETEYDPVQQYSSI 194 >ref|ZP_05926507.1| oxidoreductase Tas aldo/keto reductase family [Vibrio sp. RC341] gi|260838829|gb|EEX65480.1| oxidoreductase Tas aldo/keto reductase family [Vibrio sp. RC341] Length = 344 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/58 (53%), Positives = 37/58 (63%), Gaps = 12/58 (20%) Frame = +3 Query: 6 QAIDNSLLRLQTDYIDLYQIHWPDRRPPTLIQ------------TLIRHLQSLSSLVK 143 QAID+SL RLQTDYIDLYQIHWP R+ T Q TL+ L++LS LV+ Sbjct: 110 QAIDDSLRRLQTDYIDLYQIHWPQRQTNTFGQLNYPYPDKQEEVTLVETLEALSDLVR 167 >ref|YP_007147500.1| putative oxidoreductase, aryl-alcohol dehydrogenase like protein [Cylindrospermum stagnale PCC 7417] gi|428258870|gb|AFZ24820.1| putative oxidoreductase, aryl-alcohol dehydrogenase like protein [Cylindrospermum stagnale PCC 7417] Length = 345 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 6 QAIDNSLLRLQTDYIDLYQIHWPDRRPPTLIQTL 107 QAID+SL RLQTDYIDLYQIHWPDR P QT+ Sbjct: 111 QAIDDSLERLQTDYIDLYQIHWPDRYVPRFGQTV 144 >ref|YP_007052947.1| aldo/keto reductase [Nostoc sp. PCC 7107] gi|427363075|gb|AFY45797.1| aldo/keto reductase [Nostoc sp. PCC 7107] Length = 345 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 6 QAIDNSLLRLQTDYIDLYQIHWPDRRPPTLIQTL 107 QA+D+SL RLQTDYIDLYQIHWPDR P QT+ Sbjct: 111 QAVDDSLKRLQTDYIDLYQIHWPDRYVPRFGQTV 144