BLASTX nr result
ID: Bupleurum21_contig00003853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00003853 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA64014.1| TPA: hypothetical protein ZEAMMB73_882552 [Zea m... 91 7e-17 tpg|DAA64011.1| TPA: elongation factor 1-beta [Zea mays] 91 7e-17 gb|ACR37913.1| unknown [Zea mays] 91 7e-17 gb|ACG30952.1| elongation factor 1-beta [Zea mays] 91 7e-17 gb|ACG25737.1| elongation factor 1-beta [Zea mays] gi|195636102|... 91 7e-17 >tpg|DAA64014.1| TPA: hypothetical protein ZEAMMB73_882552 [Zea mays] Length = 85 Score = 91.3 bits (225), Expect = 7e-17 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -3 Query: 329 YGIKKMTIMMTIVDDLVSVDTVIEDHLTVEPINEYVQSCDIVAFNKI 189 YGIKKMTIM+TIVDDLVS+DT+IEDHLT EPINEYVQSCDIVAFNKI Sbjct: 39 YGIKKMTIMLTIVDDLVSIDTLIEDHLTQEPINEYVQSCDIVAFNKI 85 >tpg|DAA64011.1| TPA: elongation factor 1-beta [Zea mays] Length = 286 Score = 91.3 bits (225), Expect = 7e-17 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -3 Query: 329 YGIKKMTIMMTIVDDLVSVDTVIEDHLTVEPINEYVQSCDIVAFNKI 189 YGIKKMTIM+TIVDDLVS+DT+IEDHLT EPINEYVQSCDIVAFNKI Sbjct: 240 YGIKKMTIMLTIVDDLVSIDTLIEDHLTQEPINEYVQSCDIVAFNKI 286 >gb|ACR37913.1| unknown [Zea mays] Length = 170 Score = 91.3 bits (225), Expect = 7e-17 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -3 Query: 329 YGIKKMTIMMTIVDDLVSVDTVIEDHLTVEPINEYVQSCDIVAFNKI 189 YGIKKMTIM+TIVDDLVS+DT+IEDHLT EPINEYVQSCDIVAFNKI Sbjct: 124 YGIKKMTIMLTIVDDLVSIDTLIEDHLTQEPINEYVQSCDIVAFNKI 170 >gb|ACG30952.1| elongation factor 1-beta [Zea mays] Length = 219 Score = 91.3 bits (225), Expect = 7e-17 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -3 Query: 329 YGIKKMTIMMTIVDDLVSVDTVIEDHLTVEPINEYVQSCDIVAFNKI 189 YGIKKMTIM+TIVDDLVS+DT+IEDHLT EPINEYVQSCDIVAFNKI Sbjct: 173 YGIKKMTIMLTIVDDLVSIDTLIEDHLTQEPINEYVQSCDIVAFNKI 219 >gb|ACG25737.1| elongation factor 1-beta [Zea mays] gi|195636102|gb|ACG37519.1| elongation factor 1-beta [Zea mays] gi|238014580|gb|ACR38325.1| unknown [Zea mays] Length = 219 Score = 91.3 bits (225), Expect = 7e-17 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -3 Query: 329 YGIKKMTIMMTIVDDLVSVDTVIEDHLTVEPINEYVQSCDIVAFNKI 189 YGIKKMTIM+TIVDDLVS+DT+IEDHLT EPINEYVQSCDIVAFNKI Sbjct: 173 YGIKKMTIMLTIVDDLVSIDTLIEDHLTQEPINEYVQSCDIVAFNKI 219