BLASTX nr result
ID: Bupleurum21_contig00003848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00003848 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK47903.1| unknown [Lotus japonicus] 76 2e-12 ref|XP_003526963.1| PREDICTED: elongation factor 1-delta-like [G... 75 7e-12 dbj|BAJ22388.1| elongation factor 1 beta [Vigna unguiculata] 75 7e-12 ref|NP_001237305.1| uncharacterized protein LOC100499878 [Glycin... 75 7e-12 tpg|DAA64014.1| TPA: hypothetical protein ZEAMMB73_882552 [Zea m... 74 2e-11 >gb|AFK47903.1| unknown [Lotus japonicus] Length = 232 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +3 Query: 3 MTIVDDLVSVDTVIEDHLTVEPINEYVQSCDIVAFNKI 116 +TIVDDLVSVDT+IEDHLTVEPINEYVQSCDIVAFNKI Sbjct: 195 LTIVDDLVSVDTLIEDHLTVEPINEYVQSCDIVAFNKI 232 >ref|XP_003526963.1| PREDICTED: elongation factor 1-delta-like [Glycine max] Length = 230 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +3 Query: 3 MTIVDDLVSVDTVIEDHLTVEPINEYVQSCDIVAFNKI 116 +TIVDDLVSVDT+IE+HLTVEPINEYVQSCDIVAFNKI Sbjct: 193 LTIVDDLVSVDTLIEEHLTVEPINEYVQSCDIVAFNKI 230 >dbj|BAJ22388.1| elongation factor 1 beta [Vigna unguiculata] Length = 230 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +3 Query: 3 MTIVDDLVSVDTVIEDHLTVEPINEYVQSCDIVAFNKI 116 +TIVDDLVSVDT+IE+HLTVEPINEYVQSCDIVAFNKI Sbjct: 193 LTIVDDLVSVDTLIEEHLTVEPINEYVQSCDIVAFNKI 230 >ref|NP_001237305.1| uncharacterized protein LOC100499878 [Glycine max] gi|255627339|gb|ACU14014.1| unknown [Glycine max] Length = 230 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +3 Query: 3 MTIVDDLVSVDTVIEDHLTVEPINEYVQSCDIVAFNKI 116 +TIVDDLVSVDT+IE+HLTVEPINEYVQSCDIVAFNKI Sbjct: 193 LTIVDDLVSVDTLIEEHLTVEPINEYVQSCDIVAFNKI 230 >tpg|DAA64014.1| TPA: hypothetical protein ZEAMMB73_882552 [Zea mays] Length = 85 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 3 MTIVDDLVSVDTVIEDHLTVEPINEYVQSCDIVAFNKI 116 +TIVDDLVS+DT+IEDHLT EPINEYVQSCDIVAFNKI Sbjct: 48 LTIVDDLVSIDTLIEDHLTQEPINEYVQSCDIVAFNKI 85