BLASTX nr result
ID: Bupleurum21_contig00003791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00003791 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28261.3| unnamed protein product [Vitis vinifera] 181 5e-44 ref|XP_002270362.1| PREDICTED: dnaJ protein homolog [Vitis vinif... 181 5e-44 ref|XP_002263156.1| PREDICTED: dnaJ protein homolog [Vitis vinif... 178 4e-43 emb|CAN82708.1| hypothetical protein VITISV_000291 [Vitis vinifera] 178 4e-43 dbj|BAA35121.1| DnaJ homolog [Salix gilgiana] 178 5e-43 >emb|CBI28261.3| unnamed protein product [Vitis vinifera] Length = 394 Score = 181 bits (459), Expect = 5e-44 Identities = 85/90 (94%), Positives = 89/90 (98%) Frame = +3 Query: 3 GQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLT 182 GQK+TFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF+LT Sbjct: 233 GQKVTFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILT 292 Query: 183 HLDGRHLLIKSNPGEVIKPDQFKAISDEGM 272 HLDGR LLIKSNPGEV+KPDQFKAI+DEGM Sbjct: 293 HLDGRQLLIKSNPGEVVKPDQFKAINDEGM 322 >ref|XP_002270362.1| PREDICTED: dnaJ protein homolog [Vitis vinifera] gi|147804853|emb|CAN64692.1| hypothetical protein VITISV_030671 [Vitis vinifera] Length = 417 Score = 181 bits (459), Expect = 5e-44 Identities = 85/90 (94%), Positives = 89/90 (98%) Frame = +3 Query: 3 GQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLT 182 GQK+TFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF+LT Sbjct: 233 GQKVTFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILT 292 Query: 183 HLDGRHLLIKSNPGEVIKPDQFKAISDEGM 272 HLDGR LLIKSNPGEV+KPDQFKAI+DEGM Sbjct: 293 HLDGRQLLIKSNPGEVVKPDQFKAINDEGM 322 >ref|XP_002263156.1| PREDICTED: dnaJ protein homolog [Vitis vinifera] gi|296084435|emb|CBI24994.3| unnamed protein product [Vitis vinifera] Length = 416 Score = 178 bits (452), Expect = 4e-43 Identities = 84/90 (93%), Positives = 89/90 (98%) Frame = +3 Query: 3 GQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLT 182 GQ+ITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF+LT Sbjct: 233 GQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILT 292 Query: 183 HLDGRHLLIKSNPGEVIKPDQFKAISDEGM 272 HLDGR LLIKS+PGEV+KPDQFKAI+DEGM Sbjct: 293 HLDGRQLLIKSHPGEVVKPDQFKAINDEGM 322 >emb|CAN82708.1| hypothetical protein VITISV_000291 [Vitis vinifera] Length = 407 Score = 178 bits (452), Expect = 4e-43 Identities = 84/90 (93%), Positives = 89/90 (98%) Frame = +3 Query: 3 GQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLT 182 GQ+ITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQF+LT Sbjct: 224 GQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFILT 283 Query: 183 HLDGRHLLIKSNPGEVIKPDQFKAISDEGM 272 HLDGR LLIKS+PGEV+KPDQFKAI+DEGM Sbjct: 284 HLDGRQLLIKSHPGEVVKPDQFKAINDEGM 313 >dbj|BAA35121.1| DnaJ homolog [Salix gilgiana] Length = 420 Score = 178 bits (451), Expect = 5e-43 Identities = 84/90 (93%), Positives = 88/90 (97%) Frame = +3 Query: 3 GQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVLT 182 GQK+TFPGEADEAPDTVTGDIVFVLQQK+HPKFKRKGDDLFVEHTLSLTEALCGFQFVLT Sbjct: 235 GQKVTFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLSLTEALCGFQFVLT 294 Query: 183 HLDGRHLLIKSNPGEVIKPDQFKAISDEGM 272 HLDGR LLIKS PGEV+KPDQFKAI+DEGM Sbjct: 295 HLDGRQLLIKSQPGEVVKPDQFKAINDEGM 324