BLASTX nr result
ID: Bupleurum21_contig00003753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00003753 (380 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612583.1| Urea active transporter-like protein [Medica... 84 2e-14 ref|XP_002263043.1| PREDICTED: probable urea active transporter ... 79 4e-13 ref|XP_003523904.1| PREDICTED: probable urea active transporter ... 76 2e-12 ref|XP_002519873.1| sodium/proline symporter, putative [Ricinus ... 73 3e-11 ref|XP_004146194.1| PREDICTED: urea-proton symporter DUR3-like [... 69 4e-10 >ref|XP_003612583.1| Urea active transporter-like protein [Medicago truncatula] gi|355513918|gb|AES95541.1| Urea active transporter-like protein [Medicago truncatula] Length = 711 Score = 83.6 bits (205), Expect = 2e-14 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = -2 Query: 379 LGMFTNDRLMEKIDELNTKLNTIMLSVPEAERIYLLEKERTKKKEASEQSSQTI 218 LGMFTNDRL+EK+DELN KL+TI+ ++PEAER+YLLEKE+TKK EASEQ S +I Sbjct: 656 LGMFTNDRLVEKVDELNFKLHTIIQAIPEAERLYLLEKEKTKKLEASEQQSVSI 709 >ref|XP_002263043.1| PREDICTED: probable urea active transporter 1 [Vitis vinifera] gi|296088481|emb|CBI37472.3| unnamed protein product [Vitis vinifera] Length = 710 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -2 Query: 379 LGMFTNDRLMEKIDELNTKLNTIMLSVPEAERIYLLEKERTKKKEASE 236 LGMFTNDRLMEKI+E+N KL +I+LS+PEAER YL+EKE+ KKKEASE Sbjct: 654 LGMFTNDRLMEKIEEMNIKLQSIILSIPEAERTYLMEKEKLKKKEASE 701 >ref|XP_003523904.1| PREDICTED: probable urea active transporter 1-like [Glycine max] Length = 714 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/56 (62%), Positives = 47/56 (83%) Frame = -2 Query: 379 LGMFTNDRLMEKIDELNTKLNTIMLSVPEAERIYLLEKERTKKKEASEQSSQTIEA 212 +GMFTNDRLMEK++ELN KL TIM ++PEAER+YLLEK + KK ++SEQ + ++ A Sbjct: 659 MGMFTNDRLMEKVEELNFKLQTIMQAMPEAERLYLLEKGKAKKLDSSEQQASSLPA 714 >ref|XP_002519873.1| sodium/proline symporter, putative [Ricinus communis] gi|223540919|gb|EEF42477.1| sodium/proline symporter, putative [Ricinus communis] Length = 720 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/47 (65%), Positives = 45/47 (95%) Frame = -2 Query: 376 GMFTNDRLMEKIDELNTKLNTIMLSVPEAERIYLLEKERTKKKEASE 236 GMFTNDRLMEK++E+N+KL+TI++++PEA+++YLLEKER KK++A E Sbjct: 671 GMFTNDRLMEKVEEMNSKLHTIIMAMPEAQKLYLLEKERDKKEDALE 717 >ref|XP_004146194.1| PREDICTED: urea-proton symporter DUR3-like [Cucumis sativus] gi|449517941|ref|XP_004166002.1| PREDICTED: urea-proton symporter DUR3-like [Cucumis sativus] Length = 711 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/48 (62%), Positives = 42/48 (87%) Frame = -2 Query: 379 LGMFTNDRLMEKIDELNTKLNTIMLSVPEAERIYLLEKERTKKKEASE 236 LGMFTNDRL+EK++E+N KL+ +++++PEAERIYLLEKE +KK+ E Sbjct: 658 LGMFTNDRLIEKVNEMNLKLHALVMALPEAERIYLLEKENARKKDLLE 705