BLASTX nr result
ID: Bupleurum21_contig00003544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00003544 (636 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subun... 95 1e-17 gb|AFK48388.1| unknown [Lotus japonicus] 94 3e-17 ref|XP_003591400.1| Cytochrome c oxidase subunit 5C [Medicago tr... 92 1e-16 sp|Q9LZQ0.1|CX5C2_ARATH RecName: Full=Cytochrome c oxidase subun... 91 1e-16 ref|NP_200939.1| putative cytochrome c oxidase subunit 5C-3 [Ara... 91 2e-16 >sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome c oxidase polypeptide Vc-2 gi|18409602|gb|AAL67939.1| cytochrome c oxidase subunit 5c [Helianthus annuus] Length = 64 Score = 94.7 bits (234), Expect = 1e-17 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -2 Query: 623 GPSVVKEIVIATVLGMCAGGLWKMHHWNEQKKTRTFYDLLEKGKIGVVVEE 471 GPSVVKE+VI TVLG+ AGGLWKMHHWNEQ+KTR FYDLLEKG+I VVV+E Sbjct: 13 GPSVVKELVIGTVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVVVDE 63 >gb|AFK48388.1| unknown [Lotus japonicus] Length = 64 Score = 93.6 bits (231), Expect = 3e-17 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -2 Query: 623 GPSVVKEIVIATVLGMCAGGLWKMHHWNEQKKTRTFYDLLEKGKIGVVVEE 471 GPSVVKEIVI VLG+ AG +WKMHHWNEQ+KTRTFYDLLEKG+IGVV EE Sbjct: 13 GPSVVKEIVIGMVLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEIGVVAEE 63 >ref|XP_003591400.1| Cytochrome c oxidase subunit 5C [Medicago truncatula] gi|355480448|gb|AES61651.1| Cytochrome c oxidase subunit 5C [Medicago truncatula] Length = 64 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = -2 Query: 623 GPSVVKEIVIATVLGMCAGGLWKMHHWNEQKKTRTFYDLLEKGKIGVVVEE 471 GPSVVKEI+I LG+ AGG+WKMHHWNEQ+KTRTFYDLLEKG+I VVV+E Sbjct: 13 GPSVVKEIIIGITLGLVAGGVWKMHHWNEQRKTRTFYDLLEKGEISVVVDE 63 >sp|Q9LZQ0.1|CX5C2_ARATH RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome c oxidase polypeptide Vc-2 gi|7340711|emb|CAB82954.1| cytochrome c oxidase subunit 5c-like protein [Arabidopsis thaliana] Length = 64 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = -2 Query: 623 GPSVVKEIVIATVLGMCAGGLWKMHHWNEQKKTRTFYDLLEKGKIGVVVEE 471 GPSVVKE++I LG+ AGGLWKMHHWNEQ+KTRTFYDLLE+G+IGVV E Sbjct: 13 GPSVVKELIIGLTLGLAAGGLWKMHHWNEQRKTRTFYDLLERGEIGVVASE 63 >ref|NP_200939.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] gi|30697511|ref|NP_851239.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] gi|79331798|ref|NP_001032118.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] gi|186532634|ref|NP_001119471.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] gi|48428151|sp|Q9FLK2.1|CX5C3_ARATH RecName: Full=Probable cytochrome c oxidase subunit 5C-3; AltName: Full=Cytochrome c oxidase polypeptide Vc-3 gi|9757852|dbj|BAB08486.1| cytochrome c oxidase Vc subunit-like protein [Arabidopsis thaliana] gi|21593916|gb|AAM65881.1| cytochrome c oxidase subunit-like [Arabidopsis thaliana] gi|88010838|gb|ABD38860.1| At5g61310 [Arabidopsis thaliana] gi|332010067|gb|AED97450.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] gi|332010068|gb|AED97451.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] gi|332010069|gb|AED97452.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] gi|332010070|gb|AED97453.1| putative cytochrome c oxidase subunit 5C-3 [Arabidopsis thaliana] Length = 64 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -2 Query: 623 GPSVVKEIVIATVLGMCAGGLWKMHHWNEQKKTRTFYDLLEKGKIGVVVEE 471 GPSVVKE+VI LG+ AGGLWKMHHWNEQ+KTR FYDLLE+G+IGVVV E Sbjct: 13 GPSVVKELVIGLTLGLAAGGLWKMHHWNEQRKTRVFYDLLERGEIGVVVTE 63