BLASTX nr result
ID: Bupleurum21_contig00002122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00002122 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK46771.1| unknown [Lotus japonicus] 65 6e-09 ref|NP_001235577.1| uncharacterized protein LOC100499755 [Glycin... 64 1e-08 ref|XP_002273596.1| PREDICTED: peroxisomal membrane protein 11C ... 64 1e-08 ref|XP_002320762.1| predicted protein [Populus trichocarpa] gi|1... 64 1e-08 ref|XP_002889352.1| peroxisomal biogenesis factor 11 family prot... 64 1e-08 >gb|AFK46771.1| unknown [Lotus japonicus] Length = 235 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 PKKITPRVTGAFGFTSSLISCYQLLPSPTKSKT 101 PKK+TPRVTGAFGF SSLISCYQLLP+P KSKT Sbjct: 202 PKKVTPRVTGAFGFVSSLISCYQLLPAPVKSKT 234 >ref|NP_001235577.1| uncharacterized protein LOC100499755 [Glycine max] gi|255626311|gb|ACU13500.1| unknown [Glycine max] Length = 235 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 3 PKKITPRVTGAFGFTSSLISCYQLLPSPTKSKTV 104 PK +TPRVTGAFGF SSLISCYQLLP+P KSKTV Sbjct: 202 PKTVTPRVTGAFGFVSSLISCYQLLPAPVKSKTV 235 >ref|XP_002273596.1| PREDICTED: peroxisomal membrane protein 11C isoform 2 [Vitis vinifera] gi|225453746|ref|XP_002273544.1| PREDICTED: peroxisomal membrane protein 11C isoform 1 [Vitis vinifera] gi|296089071|emb|CBI38774.3| unnamed protein product [Vitis vinifera] Length = 235 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 PKKITPRVTGAFGFTSSLISCYQLLPSPTKSKT 101 PKK+TPRVTG FGF SSLISCYQLLPSP KSKT Sbjct: 202 PKKVTPRVTGGFGFVSSLISCYQLLPSPPKSKT 234 >ref|XP_002320762.1| predicted protein [Populus trichocarpa] gi|118489542|gb|ABK96573.1| unknown [Populus trichocarpa x Populus deltoides] gi|222861535|gb|EEE99077.1| predicted protein [Populus trichocarpa] Length = 235 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 PKKITPRVTGAFGFTSSLISCYQLLPSPTKSKT 101 PKK+TPRVTG FGF SSLISCYQLLPSP KSKT Sbjct: 202 PKKVTPRVTGGFGFVSSLISCYQLLPSPQKSKT 234 >ref|XP_002889352.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis lyrata subsp. lyrata] gi|297335194|gb|EFH65611.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis lyrata subsp. lyrata] Length = 235 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 3 PKKITPRVTGAFGFTSSLISCYQLLPSPTKSKTV 104 PKK+TPRVTGAFGF SSLISCYQLLPS KSKTV Sbjct: 202 PKKVTPRVTGAFGFASSLISCYQLLPSHPKSKTV 235