BLASTX nr result
ID: Bupleurum21_contig00000830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00000830 (551 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533627.1| nucleotide binding protein, putative [Ricinu... 63 3e-08 ref|XP_002301835.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 ref|XP_003554310.1| PREDICTED: uncharacterized protein LOC100817... 62 6e-08 ref|XP_003521322.1| PREDICTED: uncharacterized protein LOC100794... 60 2e-07 ref|XP_002268829.2| PREDICTED: uncharacterized protein LOC100246... 60 2e-07 >ref|XP_002533627.1| nucleotide binding protein, putative [Ricinus communis] gi|223526485|gb|EEF28756.1| nucleotide binding protein, putative [Ricinus communis] Length = 806 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +2 Query: 434 PKVERLKDARRELFSWVEEESLQHLSAKYCSLVPAPRST 550 PK E +DA+R L SWVEEESL+HLSAKYC LVP PRST Sbjct: 71 PKCEPARDAKRGLISWVEEESLRHLSAKYCPLVPPPRST 109 >ref|XP_002301835.1| predicted protein [Populus trichocarpa] gi|222843561|gb|EEE81108.1| predicted protein [Populus trichocarpa] Length = 703 Score = 62.4 bits (150), Expect = 5e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 434 PKVERLKDARRELFSWVEEESLQHLSAKYCSLVPAPRST 550 PK E+ +DA+R L SWVE ESL+HLSAKYC LVP PRST Sbjct: 39 PKTEQARDAKRGLISWVEAESLRHLSAKYCPLVPPPRST 77 >ref|XP_003554310.1| PREDICTED: uncharacterized protein LOC100817857 [Glycine max] Length = 788 Score = 62.0 bits (149), Expect = 6e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +2 Query: 434 PKVERLKDARRELFSWVEEESLQHLSAKYCSLVPAPRST 550 PK E ++DARR L SWVE ESL+HLSAKYC LVP PRST Sbjct: 46 PKKEVVRDARRGLLSWVEAESLRHLSAKYCPLVPPPRST 84 >ref|XP_003521322.1| PREDICTED: uncharacterized protein LOC100794246 [Glycine max] Length = 809 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 434 PKVERLKDARRELFSWVEEESLQHLSAKYCSLVPAPRST 550 PK E ++DARR L SWVE ESL+HLSAKYC L+P PRST Sbjct: 68 PKNEVVRDARRGLLSWVEAESLRHLSAKYCPLLPPPRST 106 >ref|XP_002268829.2| PREDICTED: uncharacterized protein LOC100246400 [Vitis vinifera] Length = 809 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +2 Query: 434 PKVERLKDARRELFSWVEEESLQHLSAKYCSLVPAPRST 550 PK E +DARR L SWVE +SLQHLSA+YC L+P PRST Sbjct: 48 PKSEAARDARRGLISWVEADSLQHLSARYCPLMPPPRST 86