BLASTX nr result
ID: Atropa21_contig00042956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00042956 (543 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC35123.1| CAAX prenyl protease 1-like protein [Morus notabi... 92 1e-16 ref|XP_006491174.1| PREDICTED: CAAX prenyl protease 1 homolog [C... 92 1e-16 ref|XP_006339615.1| PREDICTED: CAAX prenyl protease 1 homolog [S... 92 1e-16 gb|ESW11789.1| hypothetical protein PHAVU_008G059300g [Phaseolus... 92 1e-16 ref|XP_006444969.1| hypothetical protein CICLE_v10020054mg [Citr... 92 1e-16 ref|XP_004306744.1| PREDICTED: CAAX prenyl protease 1 homolog [F... 92 1e-16 ref|XP_004229884.1| PREDICTED: CAAX prenyl protease 1 homolog [S... 92 1e-16 ref|XP_004155836.1| PREDICTED: CAAX prenyl protease 1 homolog [C... 92 1e-16 ref|XP_004133850.1| PREDICTED: CAAX prenyl protease 1 homolog [C... 92 1e-16 ref|XP_002511907.1| caax prenyl protease ste24, putative [Ricinu... 92 1e-16 ref|XP_002302601.1| CAAX protease family protein [Populus tricho... 92 1e-16 ref|XP_004492786.1| PREDICTED: CAAX prenyl protease 1 homolog [C... 91 1e-16 ref|XP_003624056.1| CAAX prenyl protease-like protein [Medicago ... 91 1e-16 ref|XP_004306743.1| PREDICTED: CAAX prenyl protease 1 homolog [F... 91 2e-16 gb|EOX95880.1| Peptidase family M48 family protein [Theobroma ca... 91 2e-16 gb|EMJ19253.1| hypothetical protein PRUPE_ppa006168mg [Prunus pe... 90 4e-16 gb|EMJ19252.1| hypothetical protein PRUPE_ppa006168mg [Prunus pe... 90 4e-16 ref|XP_003552415.1| PREDICTED: CAAX prenyl protease 1 homolog [G... 90 4e-16 ref|XP_003534542.1| PREDICTED: CAAX prenyl protease 1 homolog [G... 90 4e-16 ref|XP_002320821.1| CAAX protease family protein [Populus tricho... 90 4e-16 >gb|EXC35123.1| CAAX prenyl protease 1-like protein [Morus notabilis] Length = 436 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCKNDEE+VAVIAHELGHWKLNH Sbjct: 263 AYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHWKLNH 305 >ref|XP_006491174.1| PREDICTED: CAAX prenyl protease 1 homolog [Citrus sinensis] Length = 424 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCKNDEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHWKLNH 293 >ref|XP_006339615.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum tuberosum] Length = 424 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCKNDEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHWKLNH 293 >gb|ESW11789.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris] Length = 424 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCKNDEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHWKLNH 293 >ref|XP_006444969.1| hypothetical protein CICLE_v10020054mg [Citrus clementina] gi|557547231|gb|ESR58209.1| hypothetical protein CICLE_v10020054mg [Citrus clementina] Length = 463 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCKNDEE+VAVIAHELGHWKLNH Sbjct: 290 AYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHWKLNH 332 >ref|XP_004306744.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. vesca] Length = 426 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCKNDEE+VAVIAHELGHWKLNH Sbjct: 253 AYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHWKLNH 295 >ref|XP_004229884.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum lycopersicum] Length = 424 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCKNDEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHWKLNH 293 >ref|XP_004155836.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus] Length = 424 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCKNDEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHWKLNH 293 >ref|XP_004133850.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus] Length = 424 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCKNDEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHWKLNH 293 >ref|XP_002511907.1| caax prenyl protease ste24, putative [Ricinus communis] gi|223549087|gb|EEF50576.1| caax prenyl protease ste24, putative [Ricinus communis] Length = 424 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCKNDEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHWKLNH 293 >ref|XP_002302601.1| CAAX protease family protein [Populus trichocarpa] gi|222844327|gb|EEE81874.1| CAAX protease family protein [Populus trichocarpa] Length = 424 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCKNDEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHWKLNH 293 >ref|XP_004492786.1| PREDICTED: CAAX prenyl protease 1 homolog [Cicer arietinum] Length = 432 Score = 91.3 bits (225), Expect = 1e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTL+QQCKNDEE+VAVIAHELGHWKLNH Sbjct: 257 AYMYGFFKNKRIVLYDTLVQQCKNDEEIVAVIAHELGHWKLNH 299 >ref|XP_003624056.1| CAAX prenyl protease-like protein [Medicago truncatula] gi|355499071|gb|AES80274.1| CAAX prenyl protease-like protein [Medicago truncatula] Length = 426 Score = 91.3 bits (225), Expect = 1e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTL+QQCKNDEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLVQQCKNDEEIVAVIAHELGHWKLNH 293 >ref|XP_004306743.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. vesca] Length = 424 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCKNDEE+VAV+AHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLIQQCKNDEEIVAVLAHELGHWKLNH 293 >gb|EOX95880.1| Peptidase family M48 family protein [Theobroma cacao] Length = 435 Score = 90.5 bits (223), Expect = 2e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGF+KNK IVLYDTLIQQCKNDEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFYKNKRIVLYDTLIQQCKNDEEIVAVIAHELGHWKLNH 293 >gb|EMJ19253.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica] Length = 351 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCK+DEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLIQQCKDDEEIVAVIAHELGHWKLNH 293 >gb|EMJ19252.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica] Length = 424 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCK+DEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLIQQCKDDEEIVAVIAHELGHWKLNH 293 >ref|XP_003552415.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max] Length = 424 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCK+DEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLIQQCKDDEEIVAVIAHELGHWKLNH 293 >ref|XP_003534542.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max] Length = 424 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCK+DEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLIQQCKDDEEIVAVIAHELGHWKLNH 293 >ref|XP_002320821.1| CAAX protease family protein [Populus trichocarpa] gi|222861594|gb|EEE99136.1| CAAX protease family protein [Populus trichocarpa] Length = 424 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +3 Query: 414 AYMYGFFKNKCIVLYDTLIQQCKNDEEVVAVIAHELGHWKLNH 542 AYMYGFFKNK IVLYDTLIQQCK+DEE+VAVIAHELGHWKLNH Sbjct: 251 AYMYGFFKNKRIVLYDTLIQQCKDDEEIVAVIAHELGHWKLNH 293