BLASTX nr result
ID: Atropa21_contig00042882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00042882 (834 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361065.1| PREDICTED: putative NPIP-like protein LOC613... 67 6e-09 >ref|XP_006361065.1| PREDICTED: putative NPIP-like protein LOC613037-like [Solanum tuberosum] Length = 499 Score = 67.4 bits (163), Expect = 6e-09 Identities = 34/71 (47%), Positives = 51/71 (71%) Frame = +2 Query: 2 SMFSLAKEVGTPLMIDKAINNRTRPSRARVKVEVDLKKDLPKRIQINCLDEDTVEVQSK* 181 ++FS+A VG PL +D+A ++TRPS ARVKVEV+L + LPKRI++ + T E+ + Sbjct: 18 ALFSMASAVGQPLDVDRATYDKTRPSTARVKVEVNLLRILPKRIRVQFNNLVTGEITNVW 77 Query: 182 QTIQYNYLPKY 214 Q I+Y+Y+P Y Sbjct: 78 QKIRYDYVPYY 88