BLASTX nr result
ID: Atropa21_contig00042803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00042803 (559 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004249793.1| PREDICTED: transcription factor MYB48-like [... 59 6e-07 >ref|XP_004249793.1| PREDICTED: transcription factor MYB48-like [Solanum lycopersicum] Length = 200 Score = 59.3 bits (142), Expect = 6e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +2 Query: 314 IQEEELRRGQWIEEEDERLAMIVAIFGECRW 406 +QEEELRRGQW+EEEDERL+M+VA+FGE RW Sbjct: 1 MQEEELRRGQWLEEEDERLSMMVAVFGERRW 31