BLASTX nr result
ID: Atropa21_contig00042627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00042627 (592 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006364803.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 58 2e-06 ref|XP_004249117.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 58 2e-06 >ref|XP_006364803.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Solanum tuberosum] Length = 536 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = +2 Query: 47 LISWKHA-DVTGDN*VLKKLTKAGEGYEHPNEGSLTK 154 LISWK DV GDN VLKKL KAGEGY+HPNEGSL K Sbjct: 245 LISWKSVVDVIGDNKVLKKLIKAGEGYDHPNEGSLAK 281 >ref|XP_004249117.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP65-like [Solanum lycopersicum] Length = 523 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = +2 Query: 47 LISWKHA-DVTGDN*VLKKLTKAGEGYEHPNEGSLTK 154 LISWK DV GDN VLKKL KAGEGY+HPNEGSL K Sbjct: 250 LISWKSVVDVIGDNKVLKKLIKAGEGYDHPNEGSLAK 286