BLASTX nr result
ID: Atropa21_contig00042552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00042552 (617 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517493.1| multidrug resistance protein 1, 2, putative ... 44 9e-06 >ref|XP_002517493.1| multidrug resistance protein 1, 2, putative [Ricinus communis] gi|223543504|gb|EEF45035.1| multidrug resistance protein 1, 2, putative [Ricinus communis] Length = 1259 Score = 44.3 bits (103), Expect(2) = 9e-06 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = -3 Query: 267 YKGPAGVERK-EDYAFIYFGAGHYAVVTYLIQ 175 Y+ PA +ERK ++Y FIY GAG YAVV YLIQ Sbjct: 724 YRNPASMERKTKEYVFIYIGAGLYAVVAYLIQ 755 Score = 31.2 bits (69), Expect(2) = 9e-06 Identities = 19/36 (52%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -2 Query: 367 QLNLP*-PNSITGNITSVLSGFIRSIFAIVWNYLLQ 263 +LN P P SI G I SVLSGFI FAIV + +++ Sbjct: 685 KLNAPEWPYSIMGAIGSVLSGFIGPTFAIVMSNMIE 720