BLASTX nr result
ID: Atropa21_contig00042410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00042410 (577 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004237542.1| PREDICTED: U-box domain-containing protein 3... 74 3e-11 ref|XP_006340592.1| PREDICTED: U-box domain-containing protein 5... 57 3e-06 >ref|XP_004237542.1| PREDICTED: U-box domain-containing protein 35-like [Solanum lycopersicum] Length = 795 Score = 73.9 bits (180), Expect = 3e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 2 NRLRALAEENMGHLVVGGSACPSPSHSQASISQEMSSDPQGH 127 +RLRALAEENMG LV+GGSACPSPSHSQAS SQEMSS+PQ + Sbjct: 735 SRLRALAEENMGPLVIGGSACPSPSHSQASTSQEMSSEPQAN 776 >ref|XP_006340592.1| PREDICTED: U-box domain-containing protein 52-like [Solanum tuberosum] Length = 770 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 2 NRLRALAEENMGHLVVGGSACPSPSHSQASISQ 100 +RLRAL EENMG LV+GGSACPSPSHSQA SQ Sbjct: 735 SRLRALGEENMGPLVIGGSACPSPSHSQAYTSQ 767