BLASTX nr result
ID: Atropa21_contig00042307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00042307 (671 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343094.1| PREDICTED: activating signal cointegrator 1 ... 65 2e-08 ref|XP_006343093.1| PREDICTED: activating signal cointegrator 1 ... 65 2e-08 ref|XP_004235689.1| PREDICTED: uncharacterized protein LOC101268... 62 1e-07 >ref|XP_006343094.1| PREDICTED: activating signal cointegrator 1 complex subunit 1-like isoform X2 [Solanum tuberosum] Length = 448 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -3 Query: 408 KMFSSYGFKYNLETYIEGALGVAMDRKKQKMVAKTWRPVST 286 + FSS GF YN T+IEG L V MDRKKQKMVAKTWRPVST Sbjct: 31 RCFSSCGFNYNSRTHIEGGLRVDMDRKKQKMVAKTWRPVST 71 >ref|XP_006343093.1| PREDICTED: activating signal cointegrator 1 complex subunit 1-like isoform X1 [Solanum tuberosum] Length = 501 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -3 Query: 408 KMFSSYGFKYNLETYIEGALGVAMDRKKQKMVAKTWRPVST 286 + FSS GF YN T+IEG L V MDRKKQKMVAKTWRPVST Sbjct: 31 RCFSSCGFNYNSRTHIEGGLRVDMDRKKQKMVAKTWRPVST 71 >ref|XP_004235689.1| PREDICTED: uncharacterized protein LOC101268850 [Solanum lycopersicum] Length = 501 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 408 KMFSSYGFKYNLETYIEGALGVAMDRKKQKMVAKTWRPVST 286 + FSS GF Y+ T+IEG L V MDRKKQKMVAKTWRPVST Sbjct: 31 RCFSSSGFSYSSRTHIEGGLLVDMDRKKQKMVAKTWRPVST 71