BLASTX nr result
ID: Atropa21_contig00042259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00042259 (633 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173498.1| hypothetical protein NitaMp161 [Nicotiana tabac... 67 3e-09 >ref|YP_173498.1| hypothetical protein NitaMp161 [Nicotiana tabacum] gi|56806663|dbj|BAD83564.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 134 Score = 67.4 bits (163), Expect = 3e-09 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +1 Query: 505 KAEHLQRLLQSPEVLWIDRMRFRLVTPSIFQFLNNHSRIILSA 633 KAE LQRLLQSPE LWID FR VTP+IFQFL+NHSRI+L+A Sbjct: 25 KAERLQRLLQSPEALWIDCGGFRRVTPTIFQFLDNHSRIMLAA 67