BLASTX nr result
ID: Atropa21_contig00041405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00041405 (526 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006347646.1| PREDICTED: uncharacterized protein LOC102578... 67 2e-09 ref|XP_004235293.1| PREDICTED: lysine-specific demethylase 5D-li... 66 5e-09 >ref|XP_006347646.1| PREDICTED: uncharacterized protein LOC102578529 [Solanum tuberosum] Length = 893 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 525 KYRPYCEIMSSSIQNVATGIKMSMVRRLSAQGKKRKATEKK 403 KYRPYCEIMSSSIQNV TGIKMSM+RR SAQGK+ + +KK Sbjct: 590 KYRPYCEIMSSSIQNVDTGIKMSMIRRSSAQGKQMRNKKKK 630 >ref|XP_004235293.1| PREDICTED: lysine-specific demethylase 5D-like [Solanum lycopersicum] Length = 605 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 525 KYRPYCEIMSSSIQNVATGIKMSMVRRLSAQGKKRKATEKK 403 KYRPYCEIMSSSIQNV TGIKMSM+RR +AQGK+ + +KK Sbjct: 560 KYRPYCEIMSSSIQNVDTGIKMSMIRRSTAQGKQMRNMKKK 600