BLASTX nr result
ID: Atropa21_contig00039803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00039803 (902 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245631.1| PREDICTED: uncharacterized protein LOC101265... 73 1e-10 >ref|XP_004245631.1| PREDICTED: uncharacterized protein LOC101265850 [Solanum lycopersicum] Length = 540 Score = 73.2 bits (178), Expect = 1e-10 Identities = 37/92 (40%), Positives = 60/92 (65%) Frame = +2 Query: 461 VVVIW*FDLDDKHRRKISFCLGYLPSLISMKSCKELIEALTEY*NNDRMVFRF*LMKMTP 640 ++ +W +L + +R+IS LG+LPS++ K IE +T + ++ +MVFRF +++ P Sbjct: 17 ILRVWWENLKECQKREISIYLGHLPSIMDFKVWPTFIEVITRFWDDKKMVFRFGDVEIKP 76 Query: 641 TLEEI*DCLDSNGTFLRIKRKLDHNLLAQTSP 736 TLEEI DCLDS GT + K++ DH++L P Sbjct: 77 TLEEIKDCLDSIGTCGKRKKRPDHHILLPDRP 108