BLASTX nr result
ID: Atropa21_contig00039099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00039099 (606 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245309.1| PREDICTED: uncharacterized protein LOC101249... 60 5e-07 >ref|XP_004245309.1| PREDICTED: uncharacterized protein LOC101249286 [Solanum lycopersicum] Length = 244 Score = 60.1 bits (144), Expect = 5e-07 Identities = 37/101 (36%), Positives = 53/101 (52%), Gaps = 10/101 (9%) Frame = +2 Query: 2 LLLQDKNHREMYVNANYTTDSISFIV--------TPQEKGYQRSENKGMRGAEQPQQRFV 157 L+LQD+N RE YVN+ DS++F+V + Q + + S NK + Sbjct: 86 LMLQDENQRESYVNSTINPDSLAFMVGNSYQNRVSKQGQRFMDSSNKSGNAYPRSAPATS 145 Query: 158 INSQRTFKNNQ--RNKSREEKYNPNVSCTYYEKTCHVHDDC 274 SQ + NQ R K ++ KY+PNV+CTY KT HV +C Sbjct: 146 QQSQAFQRQNQYPRPKVKKAKYDPNVTCTYCGKTGHVELNC 186