BLASTX nr result
ID: Atropa21_contig00039041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00039041 (638 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004236301.1| PREDICTED: BTB/POZ and TAZ domain-containing... 57 3e-06 gb|EMJ10388.1| hypothetical protein PRUPE_ppa006416mg [Prunus pe... 57 6e-06 ref|XP_006351442.1| PREDICTED: BTB/POZ and TAZ domain-containing... 56 8e-06 >ref|XP_004236301.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum lycopersicum] Length = 345 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 540 QIVLVIRCTEEQMEKHGIHLLALSHVYLVPQLK 638 Q + +CTEEQM+KHGIHLLALSHVYLVPQLK Sbjct: 72 QFLSSFQCTEEQMKKHGIHLLALSHVYLVPQLK 104 >gb|EMJ10388.1| hypothetical protein PRUPE_ppa006416mg [Prunus persica] Length = 413 Score = 56.6 bits (135), Expect = 6e-06 Identities = 31/52 (59%), Positives = 37/52 (71%), Gaps = 6/52 (11%) Frame = +3 Query: 501 ERISFLTRGACNDQIVLVIR------CTEEQMEKHGIHLLALSHVYLVPQLK 638 ER+ +T G ND ++ +R CTEE MEK+GIHLLALSHVYLVPQLK Sbjct: 124 ERVIPIT-GVPNDAVLAFLRFLYSSRCTEEHMEKYGIHLLALSHVYLVPQLK 174 >ref|XP_006351442.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 345 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 540 QIVLVIRCTEEQMEKHGIHLLALSHVYLVPQLK 638 Q + +CT+EQM+KHGIHLLALSHVYLVPQLK Sbjct: 72 QFLSSFKCTKEQMKKHGIHLLALSHVYLVPQLK 104