BLASTX nr result
ID: Atropa21_contig00038177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00038177 (503 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABG37658.1| integrase [Populus trichocarpa] 65 7e-09 gb|ABG37655.1| integrase [Populus trichocarpa] 64 3e-08 gb|EOY21213.1| Uncharacterized protein TCM_012596 [Theobroma cacao] 63 4e-08 gb|ABG37654.1| integrase [Populus trichocarpa] 61 2e-07 gb|ABG37652.1| integrase [Populus trichocarpa] 59 9e-07 ref|XP_006352955.1| PREDICTED: F-box protein At3g07870-like [Sol... 58 1e-06 ref|XP_006493043.1| PREDICTED: uncharacterized protein LOC102611... 57 2e-06 gb|ABD63142.1| Retrotransposon gag protein [Asparagus officinalis] 57 3e-06 gb|ABB55347.1| hypothetical protein 9.t00011 [Asparagus officina... 57 3e-06 gb|ABG37653.1| integrase [Populus trichocarpa] 56 6e-06 gb|EPS63230.1| hypothetical protein M569_11557 [Genlisea aurea] 55 7e-06 >gb|ABG37658.1| integrase [Populus trichocarpa] Length = 1139 Score = 65.5 bits (158), Expect = 7e-09 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 492 QVHQVENFQRPYNNPFSNTYNPGWRNHPNFSWR 394 Q H + NFQRP +NP+S TYNPGWRNHPNFSW+ Sbjct: 118 QAHALNNFQRPNHNPYSQTYNPGWRNHPNFSWK 150 >gb|ABG37655.1| integrase [Populus trichocarpa] Length = 1263 Score = 63.5 bits (153), Expect = 3e-08 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 492 QVHQVENFQRPYNNPFSNTYNPGWRNHPNFSWR 394 Q H + +FQRP +NP+S TYNPGWRNHPNFSW+ Sbjct: 535 QAHALNSFQRPNHNPYSQTYNPGWRNHPNFSWK 567 >gb|EOY21213.1| Uncharacterized protein TCM_012596 [Theobroma cacao] Length = 498 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 501 NQAQVHQVENFQRPYNNPFSNTYNPGWRNHPNFSW 397 N A VH V NF R NNP+SNTYN GWRNHPNFSW Sbjct: 145 NFASVHFVGNFNRQQNNPYSNTYNSGWRNHPNFSW 179 >gb|ABG37654.1| integrase [Populus trichocarpa] Length = 1136 Score = 60.8 bits (146), Expect = 2e-07 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -3 Query: 492 QVHQVENFQRPYNNPFSNTYNPGWRNHPNFSWR 394 Q H + +FQRP +NP+S TYNPGW NHPNFSW+ Sbjct: 30 QAHGLNSFQRPNHNPYSQTYNPGWSNHPNFSWK 62 Score = 58.5 bits (140), Expect = 9e-07 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -3 Query: 492 QVHQVENFQRPYNNPFSNTYNPGWRNHPNFSWR 394 Q H + +FQRP +N +S TYNPGWR+HPNFSW+ Sbjct: 738 QAHALNSFQRPNHNSYSQTYNPGWRDHPNFSWK 770 >gb|ABG37652.1| integrase [Populus trichocarpa] Length = 747 Score = 58.5 bits (140), Expect = 9e-07 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -3 Query: 492 QVHQVENFQRPYNNPFSNTYNPGWRNHPNFSWR 394 Q H + +FQRP +NP+S TYNPGWRNH NF+W+ Sbjct: 36 QAHALNSFQRPNHNPYSQTYNPGWRNHLNFNWK 68 >ref|XP_006352955.1| PREDICTED: F-box protein At3g07870-like [Solanum tuberosum] Length = 413 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 96 MSEYLSQELLIEIFQRLRTKSIIQCTSVCKSW 1 MSEYL QE+LIEIF RL TKS+IQCTSVCKSW Sbjct: 1 MSEYLPQEVLIEIFLRLPTKSLIQCTSVCKSW 32 >ref|XP_006493043.1| PREDICTED: uncharacterized protein LOC102611356 [Citrus sinensis] Length = 1121 Score = 57.4 bits (137), Expect = 2e-06 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = -3 Query: 492 QVHQVENFQRPYNNPFSNTYNPGWRNHPNFSWR 394 QVH ++++++ NNP+S TYNP WRNHPNFSW+ Sbjct: 120 QVHVLQSYEKTPNNPYSPTYNPNWRNHPNFSWK 152 >gb|ABD63142.1| Retrotransposon gag protein [Asparagus officinalis] Length = 1788 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -3 Query: 471 FQRPYNNPFSNTYNPGWRNHPNFSW 397 FQRP N+PFS TYNPGWRNHPNF+W Sbjct: 229 FQRPRNDPFSPTYNPGWRNHPNFAW 253 >gb|ABB55347.1| hypothetical protein 9.t00011 [Asparagus officinalis] Length = 149 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -3 Query: 471 FQRPYNNPFSNTYNPGWRNHPNFSW 397 FQRP N+PFS TYNPGWRNHPNF+W Sbjct: 109 FQRPRNDPFSPTYNPGWRNHPNFAW 133 >gb|ABG37653.1| integrase [Populus trichocarpa] Length = 619 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -3 Query: 492 QVHQVENFQRPYNNPFSNTYNPGWRNHPNFSWR 394 Q H + +FQRP +NP+S TYN GWRNH NFSW+ Sbjct: 19 QAHALNSFQRPNHNPYSQTYNLGWRNHLNFSWK 51 >gb|EPS63230.1| hypothetical protein M569_11557 [Genlisea aurea] Length = 607 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -3 Query: 495 AQVHQVENFQRPYNNPFSNTYNPGWRNHPNFSWR 394 A+V+ R N+P+SNTYNPGWRNHPNFSWR Sbjct: 209 AEVNAATGPSRYKNDPYSNTYNPGWRNHPNFSWR 242