BLASTX nr result
ID: Atropa21_contig00038173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00038173 (1182 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004234336.1| PREDICTED: uncharacterized protein LOC101256... 43 8e-07 >ref|XP_004234336.1| PREDICTED: uncharacterized protein LOC101256846 [Solanum lycopersicum] Length = 985 Score = 43.1 bits (100), Expect(2) = 8e-07 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 2/38 (5%) Frame = +1 Query: 601 F*SAGLASPFGRGESSMN--SGVSSIRFDRKVQSCVYL 708 F SAG A PFG+G+S MN SGV S+R KVQSC YL Sbjct: 941 FQSAGPACPFGKGDSCMNQVSGVPSVRSGVKVQSCDYL 978 Score = 37.7 bits (86), Expect(2) = 8e-07 Identities = 16/24 (66%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = +2 Query: 521 FTISS-FWGCPVVFFTRLAGYGLP 589 FT+S FW CPV+FF RL YGLP Sbjct: 913 FTVSFYFWDCPVMFFARLTSYGLP 936