BLASTX nr result
ID: Atropa21_contig00037703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00037703 (504 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361065.1| PREDICTED: putative NPIP-like protein LOC613... 56 3e-07 >ref|XP_006361065.1| PREDICTED: putative NPIP-like protein LOC613037-like [Solanum tuberosum] Length = 499 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 30/61 (49%), Positives = 37/61 (60%) Frame = -1 Query: 450 ARVKVLVDLNSDLPKSVQMDIINEDTMEERTETFKIRYDHLPKYCFECKLQGHSEEECRI 271 ARVKV V+L LPK +++ N T E KIRYD++P YC CK QGH E +CR Sbjct: 45 ARVKVEVNLLRILPKRIRVQFNNLVTGEITNVWQKIRYDYVPYYCKRCKHQGHREADCRT 104 Query: 270 L 268 L Sbjct: 105 L 105 Score = 23.5 bits (49), Expect(2) = 3e-07 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 503 GKPLQLNLATINKTRP 456 G+PL ++ AT +KTRP Sbjct: 27 GQPLDVDRATYDKTRP 42