BLASTX nr result
ID: Atropa21_contig00037106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00037106 (684 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006351985.1| PREDICTED: serine/threonine-protein phosphat... 62 8e-15 >ref|XP_006351985.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog [Solanum tuberosum] Length = 585 Score = 62.0 bits (149), Expect(2) = 8e-15 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = +2 Query: 2 ALGHQESYMLAYNTS*DPTTSNAEKVLIEKFSRINIESMTVASLG 136 A GHQ SY LA + DPT S+AEKVL EKFSRI++ESMT ASLG Sbjct: 470 ARGHQNSYKLALSVGNDPTASDAEKVLAEKFSRISVESMTAASLG 514 Score = 44.7 bits (104), Expect(2) = 8e-15 Identities = 26/62 (41%), Positives = 32/62 (51%) Frame = +1 Query: 133 GMMLSFTPHYTSPGEYEEQPTVYVPRHHNLTLPRSGARGREHQGKTSNKRDQGHMDYQLV 312 G LSF P YT P EYEE P V V R + R R R +G R Q +D++LV Sbjct: 514 GTRLSFAPDYTPPTEYEEPPIVPVRRRQRQAVHRDEVRSRGPRG----GRGQHRVDHRLV 569 Query: 313 DQ 318 D+ Sbjct: 570 DE 571