BLASTX nr result
ID: Atropa21_contig00037009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00037009 (923 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173413.1| hypothetical protein NitaMp069 [Nicotiana tabac... 69 2e-09 >ref|YP_173413.1| hypothetical protein NitaMp069 [Nicotiana tabacum] gi|56806576|dbj|BAD83477.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 136 Score = 68.9 bits (167), Expect = 2e-09 Identities = 54/114 (47%), Positives = 63/114 (55%), Gaps = 6/114 (5%) Frame = +2 Query: 566 LIHLGGV*VQLFELIEMNLTVP*DNIERRRIQLSN-----GITVPAIPMKKAER*RSGHT 730 LI LGGV Q + E N + P N ERRR+QLSN + +KK S Sbjct: 11 LIRLGGV--QRTQRDEPN-SAPSQNRERRRMQLSNRDHSSDHSFEGRKVKKCLATLSAEQ 67 Query: 731 LRRTILSKHPL*PIKKTYGMKERKSNSA-HLEEDRPVTIDLSTPGIGQRHTRHT 889 ++ L KT GMKERKS+SA EEDRP TIDLS PG+GQRHTRHT Sbjct: 68 SYQSALFNQS----SKTDGMKERKSSSAARPEEDRPATIDLSIPGLGQRHTRHT 117