BLASTX nr result
ID: Atropa21_contig00037005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00037005 (806 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006346080.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-16 ref|XP_004244333.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-14 gb|EXB51073.1| hypothetical protein L484_023776 [Morus notabilis] 43 3e-08 ref|XP_002531775.1| pentatricopeptide repeat-containing protein,... 45 6e-06 >ref|XP_006346080.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum tuberosum] Length = 527 Score = 63.2 bits (152), Expect(2) = 5e-16 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +3 Query: 147 IEPNTHISSSLISMYSYAGNMDSAKQVLDEFSEHN 251 IEPNTHI SSLISMYS AG+M SAKQVLDEFSEHN Sbjct: 156 IEPNTHICSSLISMYSCAGDMASAKQVLDEFSEHN 190 Score = 48.1 bits (113), Expect(2) = 5e-16 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +2 Query: 2 MESLLLYERLLSDGVLPDSHTCTFVLKAYSI*KLLLK 112 +ESL LYERL++DG+ PDSHT TFVLKA S K +L+ Sbjct: 107 IESLFLYERLVTDGLSPDSHTYTFVLKACSHLKAVLE 143 >ref|XP_004244333.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum lycopersicum] Length = 527 Score = 56.6 bits (135), Expect(2) = 4e-14 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 147 IEPNTHISSSLISMYSYAGNMDSAKQVLDEFSEHN 251 I+PNTHI SSLISMYS AG+M SA+QVLDEFSE N Sbjct: 156 IKPNTHICSSLISMYSCAGDMASARQVLDEFSEPN 190 Score = 48.1 bits (113), Expect(2) = 4e-14 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +2 Query: 2 MESLLLYERLLSDGVLPDSHTCTFVLKAYSI*KLLLK 112 +ESL LYERL++DG+ PDSHT TFVLKA S K +L+ Sbjct: 107 IESLFLYERLVTDGLSPDSHTYTFVLKACSHMKAVLE 143 >gb|EXB51073.1| hypothetical protein L484_023776 [Morus notabilis] Length = 523 Score = 42.7 bits (99), Expect(2) = 3e-08 Identities = 19/37 (51%), Positives = 28/37 (75%) Frame = +3 Query: 147 IEPNTHISSSLISMYSYAGNMDSAKQVLDEFSEHNVL 257 I P+TH+ SSLI+MY+ +G++ A++VL EF E N L Sbjct: 138 IAPDTHVHSSLINMYASSGSIACAERVLGEFKEENTL 174 Score = 42.0 bits (97), Expect(2) = 3e-08 Identities = 22/41 (53%), Positives = 31/41 (75%) Frame = +2 Query: 8 SLLLYERLLSDGVLPDSHTCTFVLKAYSI*KLLLKVNKHMH 130 SLL+YE+LL +G++PD+ T TFVLKA S K L++ K +H Sbjct: 91 SLLMYEKLLMNGLIPDNFTYTFVLKACSHMKALIE-GKQVH 130 >ref|XP_002531775.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528611|gb|EEF30631.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 498 Score = 44.7 bits (104), Expect(2) = 6e-06 Identities = 22/39 (56%), Positives = 28/39 (71%) Frame = +3 Query: 147 IEPNTHISSSLISMYSYAGNMDSAKQVLDEFSEHNVLGE 263 I PNTHI SSLI MY+ +G++ A+ VL EFSE N L + Sbjct: 118 ISPNTHIHSSLIHMYTSSGSIVEAECVLREFSEENTLAK 156 Score = 32.3 bits (72), Expect(2) = 6e-06 Identities = 18/34 (52%), Positives = 23/34 (67%) Frame = +2 Query: 5 ESLLLYERLLSDGVLPDSHTCTFVLKAYSI*KLL 106 +SLLL+ LL + PD++T TFVLKA S K L Sbjct: 70 DSLLLFNELLLGCLKPDNYTYTFVLKACSNQKAL 103