BLASTX nr result
ID: Atropa21_contig00036968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00036968 (838 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004240666.1| PREDICTED: uncharacterized protein LOC101255... 67 1e-08 >ref|XP_004240666.1| PREDICTED: uncharacterized protein LOC101255404 [Solanum lycopersicum] Length = 880 Score = 66.6 bits (161), Expect = 1e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -1 Query: 541 IGKFQNSSQETITLNDVRRWACNT*KMTFGINVFAMNDGLFLFE 410 +G+F ++ QET LND RRWACNT K G+NVFAMNDG FLFE Sbjct: 823 VGRFHDTLQETPALNDARRWACNTWKSAIGVNVFAMNDGQFLFE 866