BLASTX nr result
ID: Atropa21_contig00036725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00036725 (528 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004231415.1| PREDICTED: uncharacterized protein LOC101266... 52 3e-06 >ref|XP_004231415.1| PREDICTED: uncharacterized protein LOC101266877 [Solanum lycopersicum] Length = 1537 Score = 52.0 bits (123), Expect(2) = 3e-06 Identities = 30/50 (60%), Positives = 34/50 (68%) Frame = -1 Query: 504 VFQLDVNSDFLHVDLHEEVCMKIISGLMDSYSSFHTPVFKLRKFLYGLKQ 355 +FQLDVN+ FLH DLHEEV MK+ GL S V KL+K LYGLKQ Sbjct: 1133 MFQLDVNNAFLHGDLHEEVYMKLPPGLEVPNSEL---VCKLKKSLYGLKQ 1179 Score = 24.6 bits (52), Expect(2) = 3e-06 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -3 Query: 352 SRQWFSQLSDSLLSR 308 SRQW+S+L+++L SR Sbjct: 1181 SRQWYSKLTEALSSR 1195