BLASTX nr result
ID: Atropa21_contig00034923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00034923 (516 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004236336.1| PREDICTED: SWI/SNF complex component SNF12 h... 130 1e-28 ref|XP_006351478.1| PREDICTED: SWI/SNF complex component SNF12 h... 127 1e-27 gb|EXB98011.1| SWI/SNF complex component SNF12-like protein [Mor... 61 2e-07 ref|XP_004297565.1| PREDICTED: SWI/SNF complex component SNF12 h... 57 3e-06 >ref|XP_004236336.1| PREDICTED: SWI/SNF complex component SNF12 homolog [Solanum lycopersicum] Length = 526 Score = 130 bits (328), Expect = 1e-28 Identities = 70/104 (67%), Positives = 76/104 (73%), Gaps = 2/104 (1%) Frame = +3 Query: 210 MNNNNPVKNISLSNSVPIQIPQSLPINQHQPPSHHFTQSPAQRASHYPGHFQLSEPQRSH 389 MNNNNPVKN+SL SVPIQIPQS+PIN +QP HF+QSPAQR SH+PGHFQLSE RSH Sbjct: 1 MNNNNPVKNVSLGTSVPIQIPQSMPINHNQPAVRHFSQSPAQRGSHFPGHFQLSE-SRSH 59 Query: 390 V--QGQAQAFSHLITSRTHTNVGGVXXXXXXXXXXASGGTRKVL 515 QGQAQAFSH ITS +TN GV ASGG RKVL Sbjct: 60 APFQGQAQAFSHFITSGVNTN-AGVLSPAASTPNTASGGARKVL 102 >ref|XP_006351478.1| PREDICTED: SWI/SNF complex component SNF12 homolog [Solanum tuberosum] Length = 526 Score = 127 bits (320), Expect = 1e-27 Identities = 68/104 (65%), Positives = 76/104 (73%), Gaps = 2/104 (1%) Frame = +3 Query: 210 MNNNNPVKNISLSNSVPIQIPQSLPINQHQPPSHHFTQSPAQRASHYPGHFQLSEPQRSH 389 MNNNNPVKN+SL SVP+QIPQS+PI +QP + HF+QSPAQR SH+PGHFQLSE RSH Sbjct: 1 MNNNNPVKNVSLGTSVPMQIPQSMPIYHNQPAARHFSQSPAQRGSHFPGHFQLSE-SRSH 59 Query: 390 V--QGQAQAFSHLITSRTHTNVGGVXXXXXXXXXXASGGTRKVL 515 QGQAQAFSH ITS +TN GV ASGG RKVL Sbjct: 60 APFQGQAQAFSHFITSGVNTN-AGVSSPAASTPNTASGGARKVL 102 >gb|EXB98011.1| SWI/SNF complex component SNF12-like protein [Morus notabilis] Length = 544 Score = 60.8 bits (146), Expect = 2e-07 Identities = 37/83 (44%), Positives = 45/83 (54%), Gaps = 14/83 (16%) Frame = +3 Query: 204 LAMNNNNPVKNIS----LSNSVPIQIPQSLPINQHQPPSHHFTQSPAQRASHYPGHFQLS 371 ++MNNNN VKN+ NS +PQS+P+N HQP Q Q SH+PGHFQLS Sbjct: 1 MSMNNNNQVKNVGAPPHFGNSG--MVPQSMPLN-HQPHLLSQAQPQTQSGSHFPGHFQLS 57 Query: 372 EPQ----------RSHVQGQAQA 410 EPQ +H Q QA A Sbjct: 58 EPQAQALAQSQFVNAHAQAQAHA 80 >ref|XP_004297565.1| PREDICTED: SWI/SNF complex component SNF12 homolog [Fragaria vesca subsp. vesca] Length = 535 Score = 56.6 bits (135), Expect = 3e-06 Identities = 36/91 (39%), Positives = 46/91 (50%), Gaps = 21/91 (23%) Frame = +3 Query: 213 NNNNPVKNISLSNSV--PIQIPQSLPINQHQPPSHHFTQSPAQRASHYPGHFQLSEPQRS 386 NNNN KN+ + P +PQS+ IN HQP +Q AQ +SH+PGHFQLSEPQ Sbjct: 5 NNNNQAKNVGVPPHFGNPGAVPQSMSIN-HQPHLLSQSQPQAQGSSHFPGHFQLSEPQPQ 63 Query: 387 -------------------HVQGQAQAFSHL 422 H+Q QAQ+ + L Sbjct: 64 AMTQAQYLAQNQAAHAQFVHLQAQAQSLAQL 94