BLASTX nr result
ID: Atropa21_contig00034319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00034319 (731 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006353329.1| PREDICTED: F-box/LRR-repeat protein At3g4888... 59 2e-06 >ref|XP_006353329.1| PREDICTED: F-box/LRR-repeat protein At3g48880-like isoform X1 [Solanum tuberosum] gi|565373544|ref|XP_006353330.1| PREDICTED: F-box/LRR-repeat protein At3g48880-like isoform X2 [Solanum tuberosum] Length = 318 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 628 EIEAFVMEEGDCPVRRWEDLDIDILVKIFQSFDL 729 +IEA VMEEG+ PVRRWEDL+ID+LV IFQSFDL Sbjct: 9 KIEAVVMEEGNSPVRRWEDLNIDMLVNIFQSFDL 42