BLASTX nr result
ID: Atropa21_contig00033867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00033867 (1171 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_817244.1| ORF45d [Pinus koraiensis] gi|29469761|gb|AAO740... 59 3e-06 >ref|NP_817244.1| ORF45d [Pinus koraiensis] gi|29469761|gb|AAO74089.1| ORF45d [Pinus koraiensis] Length = 45 Score = 59.3 bits (142), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 732 LIMCQEPDLNW*HEDFQSSGLPTELSQLFPM*YP 631 L CQEPDLNW HEDFQSS LPTELS+LFP+ +P Sbjct: 8 LTSCQEPDLNWWHEDFQSSALPTELSRLFPVDHP 41