BLASTX nr result
ID: Atropa21_contig00033368
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00033368 (527 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004239572.1| PREDICTED: ADP-ribosylation factor GTPase-ac... 57 2e-06 ref|XP_006343186.1| PREDICTED: ADP-ribosylation factor GTPase-ac... 57 3e-06 ref|XP_006343185.1| PREDICTED: ADP-ribosylation factor GTPase-ac... 57 3e-06 >ref|XP_004239572.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3 [Solanum lycopersicum] Length = 1345 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 525 HALDGESKTPYDLALGSSFNDNEILNLLSGTN 430 HALDGESKTPYDLALGS+F+D ++LNLLS TN Sbjct: 785 HALDGESKTPYDLALGSNFDDVDVLNLLSDTN 816 >ref|XP_006343186.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like isoform X2 [Solanum tuberosum] Length = 814 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 525 HALDGESKTPYDLALGSSFNDNEILNLLSGTNA 427 HALDGESKTPYDLALGS+F+D ++LNLLS NA Sbjct: 782 HALDGESKTPYDLALGSNFDDVDVLNLLSDANA 814 >ref|XP_006343185.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like isoform X1 [Solanum tuberosum] Length = 817 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 525 HALDGESKTPYDLALGSSFNDNEILNLLSGTNA 427 HALDGESKTPYDLALGS+F+D ++LNLLS NA Sbjct: 785 HALDGESKTPYDLALGSNFDDVDVLNLLSDANA 817