BLASTX nr result
ID: Atropa21_contig00030892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00030892 (605 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15836.3| unnamed protein product [Vitis vinifera] 59 1e-06 ref|XP_002269081.1| PREDICTED: uncharacterized protein LOC100267... 57 5e-06 gb|EXC19559.1| hypothetical protein L484_010690 [Morus notabilis] 56 9e-06 >emb|CBI15836.3| unnamed protein product [Vitis vinifera] Length = 119 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 570 EREREMCPLRIILIFLSAPLAGFFVLRNLKSQPNV 466 E + EMCPLR+ILIFLSA LAGFFVLRNLKSQP V Sbjct: 28 EGKIEMCPLRLILIFLSATLAGFFVLRNLKSQPQV 62 >ref|XP_002269081.1| PREDICTED: uncharacterized protein LOC100267277 [Vitis vinifera] Length = 87 Score = 56.6 bits (135), Expect = 5e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 555 MCPLRIILIFLSAPLAGFFVLRNLKSQPNV 466 MCPLR+ILIFLSA LAGFFVLRNLKSQP V Sbjct: 1 MCPLRLILIFLSATLAGFFVLRNLKSQPQV 30 >gb|EXC19559.1| hypothetical protein L484_010690 [Morus notabilis] Length = 94 Score = 55.8 bits (133), Expect = 9e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 555 MCPLRIILIFLSAPLAGFFVLRNLKSQP 472 MCPLRIILIFLSA LAGFFVLRNLKSQP Sbjct: 1 MCPLRIILIFLSATLAGFFVLRNLKSQP 28