BLASTX nr result
ID: Atropa21_contig00030706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00030706 (1951 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71471.1| hypothetical protein VITISV_038995 [Vitis vinifera] 68 1e-08 >emb|CAN71471.1| hypothetical protein VITISV_038995 [Vitis vinifera] Length = 324 Score = 68.2 bits (165), Expect = 1e-08 Identities = 30/65 (46%), Positives = 43/65 (66%) Frame = +2 Query: 422 QFMSLLLSHEFLGFVDGSIPTPNSIICDASGSQHSNPLYHT*LRVDQSVRYWLFEILFRE 601 +F+ +L+S++ LG+VDG+ P P CDA G NP YH +R DQSVR WL L +E Sbjct: 72 KFLPVLISNDLLGYVDGTFPCPPQYTCDAEGRYTPNPAYHAWIRTDQSVRSWLNATLTQE 131 Query: 602 VLIDV 616 +L+D+ Sbjct: 132 MLLDL 136