BLASTX nr result
ID: Atropa21_contig00030251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00030251 (517 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import recep... 95 8e-18 ref|XP_004242882.1| PREDICTED: mitochondrial import receptor sub... 94 2e-17 ref|XP_006360661.1| PREDICTED: mitochondrial import receptor sub... 91 2e-16 ref|XP_004240126.1| PREDICTED: mitochondrial import receptor sub... 90 3e-16 gb|EXC12836.1| Mitochondrial import receptor subunit TOM7-1 [Mor... 83 3e-14 gb|ESW32215.1| hypothetical protein PHAVU_002G303100g [Phaseolus... 83 3e-14 gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus pe... 83 3e-14 ref|XP_004151870.1| PREDICTED: mitochondrial import receptor sub... 82 7e-14 ref|XP_002335848.1| predicted protein [Populus trichocarpa] gi|5... 82 9e-14 ref|XP_004299770.1| PREDICTED: mitochondrial import receptor sub... 81 1e-13 ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [S... 81 1e-13 gb|AFK44684.1| unknown [Lotus japonicus] 81 2e-13 ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1... 81 2e-13 ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1... 81 2e-13 gb|EPS63209.1| hypothetical protein M569_11578 [Genlisea aurea] 80 2e-13 ref|XP_006473187.1| PREDICTED: mitochondrial import receptor sub... 80 4e-13 ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 80 4e-13 ref|XP_002308124.1| Mitochondrial import receptor subunit TOM7 f... 80 4e-13 ref|XP_006477861.1| PREDICTED: mitochondrial import receptor sub... 79 5e-13 ref|XP_006442420.1| hypothetical protein CICLE_v10023194mg [Citr... 79 5e-13 >sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 gi|3319774|emb|CAA76125.1| TOM7 protein [Solanum tuberosum] Length = 72 Score = 95.1 bits (235), Expect = 8e-18 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = -3 Query: 320 VSRFAKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 V +F KEWGTWTAKKAKVITHYGFIPLVII+GMNSEPKPSLSQL+SPV Sbjct: 25 VGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72 >ref|XP_004242882.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum lycopersicum] Length = 77 Score = 93.6 bits (231), Expect = 2e-17 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = -3 Query: 320 VSRFAKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 V +F KEWGTW+AKKAKVITHYGFIPLVII+GMNSEPKPSLSQL+SPV Sbjct: 30 VGKFVKEWGTWSAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 77 >ref|XP_006360661.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum tuberosum] Length = 78 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -3 Query: 320 VSRFAKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 V F K+W TWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQL+SPV Sbjct: 31 VYTFVKDWSTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 78 >ref|XP_004240126.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum lycopersicum] Length = 78 Score = 89.7 bits (221), Expect = 3e-16 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -3 Query: 320 VSRFAKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 V F K+W TWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQL+SPV Sbjct: 31 VYTFVKDWTTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 78 >gb|EXC12836.1| Mitochondrial import receptor subunit TOM7-1 [Morus notabilis] Length = 71 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -3 Query: 317 SRFAKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 ++ KEW TW AKKAKVITHYGFIPLVII+GMNS+PKP LSQL+SPV Sbjct: 25 AQLVKEWTTWAAKKAKVITHYGFIPLVIIIGMNSDPKPHLSQLLSPV 71 >gb|ESW32215.1| hypothetical protein PHAVU_002G303100g [Phaseolus vulgaris] Length = 72 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -3 Query: 320 VSRFAKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 VS KEW TWT +KAKVITHYGFIPLVII+GMNS+PKP+LSQL SPV Sbjct: 25 VSESLKEWTTWTMRKAKVITHYGFIPLVIIIGMNSDPKPALSQLFSPV 72 >gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] Length = 73 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = -3 Query: 320 VSRFAKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 V++ KEW TW KKAKV+THYGFIPL+I++GMNSEPKP LSQL+SPV Sbjct: 26 VAQSVKEWSTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPQLSQLLSPV 73 >ref|XP_004151870.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] gi|449516268|ref|XP_004165169.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] Length = 73 Score = 82.0 bits (201), Expect = 7e-14 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -3 Query: 305 KEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 KEW TW KKAKV+THYGFIPLVII+GMNSEPKP LSQL+SPV Sbjct: 31 KEWTTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73 >ref|XP_002335848.1| predicted protein [Populus trichocarpa] gi|566215807|ref|XP_006372198.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] gi|550318729|gb|ERP49995.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] Length = 74 Score = 81.6 bits (200), Expect = 9e-14 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -3 Query: 317 SRFAKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISP 180 S++ KEW TWT KKAKVITHYGFIP++II+GMNSEPKP + QL+SP Sbjct: 28 SQYVKEWSTWTFKKAKVITHYGFIPMIIIIGMNSEPKPQIYQLLSP 73 >ref|XP_004299770.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Fragaria vesca subsp. vesca] Length = 73 Score = 81.3 bits (199), Expect = 1e-13 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -3 Query: 320 VSRFAKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 +++ KEW WT KKAKV+THYGFIPL+II+GMNS+PKP LSQL+SPV Sbjct: 26 ITQAVKEWTNWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 73 >ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] gi|241930169|gb|EES03314.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] Length = 79 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -3 Query: 314 RFAKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 R KEW TWT KKAKV+ HYGFIPLVI++GMNSEPKPS+ QL+SPV Sbjct: 34 RLVKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQLLSPV 79 >gb|AFK44684.1| unknown [Lotus japonicus] Length = 72 Score = 80.9 bits (198), Expect = 2e-13 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -3 Query: 305 KEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 KEW TWT +KAKV+THYGFIPL+II+GMNS+PKP LSQL+SPV Sbjct: 30 KEWTTWTMRKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 72 >ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] gi|223537179|gb|EEF38812.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] Length = 75 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 305 KEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 KEW TWT KKAKVITHYGFIPLV+I+GMNSEPKP L QL++PV Sbjct: 33 KEWSTWTLKKAKVITHYGFIPLVVIIGMNSEPKPQLYQLLTPV 75 >ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195606532|gb|ACG25096.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195637638|gb|ACG38287.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195658849|gb|ACG48892.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|223945683|gb|ACN26925.1| unknown [Zea mays] gi|413950686|gb|AFW83335.1| import receptor subunit TOM7-1 [Zea mays] Length = 79 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -3 Query: 314 RFAKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 R KEW TWT KKAKV+ HYGFIPLVI++GMNSEPKPS+ QL+SPV Sbjct: 34 RLMKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQLLSPV 79 >gb|EPS63209.1| hypothetical protein M569_11578 [Genlisea aurea] Length = 81 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = -3 Query: 317 SRFAKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 ++ K+W W KKAKVITHYGFIPL+II+GMNSEPKPS+SQL+SPV Sbjct: 35 TKLVKQWSNWGLKKAKVITHYGFIPLIIIIGMNSEPKPSISQLLSPV 81 >ref|XP_006473187.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Citrus sinensis] Length = 71 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -3 Query: 305 KEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 KEW TW KKAKVITHYGFIPLVII+GMNS+PKP L QL+SPV Sbjct: 29 KEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLHQLLSPV 71 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] Length = 72 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -3 Query: 317 SRFAKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 S KEW TW +KAKVITHYGFIPLVII+GMNS+PKP LSQL+SPV Sbjct: 26 SECLKEWTTWAMRKAKVITHYGFIPLVIIIGMNSDPKPPLSQLLSPV 72 >ref|XP_002308124.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] gi|222854100|gb|EEE91647.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] Length = 74 Score = 79.7 bits (195), Expect = 4e-13 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -3 Query: 317 SRFAKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISP 180 S++ KEW TW+ KKAKVITHYGFIP++II+GMNSEPKP + QL+SP Sbjct: 28 SQYFKEWSTWSFKKAKVITHYGFIPMIIIIGMNSEPKPQIHQLLSP 73 >ref|XP_006477861.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Citrus sinensis] Length = 72 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -3 Query: 305 KEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 KEW TWT KKAKV+THYGFIPL+II+GMNS+PKP + QL+SPV Sbjct: 30 KEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 72 >ref|XP_006442420.1| hypothetical protein CICLE_v10023194mg [Citrus clementina] gi|557544682|gb|ESR55660.1| hypothetical protein CICLE_v10023194mg [Citrus clementina] Length = 72 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -3 Query: 305 KEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLISPV 177 KEW TWT KKAKV+THYGFIPL+II+GMNS+PKP + QL+SPV Sbjct: 30 KEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 72