BLASTX nr result
ID: Atropa21_contig00029876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00029876 (518 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT09624.1| Zinc finger protein 410 [Aegilops tauschii] 56 4e-06 >gb|EMT09624.1| Zinc finger protein 410 [Aegilops tauschii] Length = 1424 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +2 Query: 50 SIVRSLTLHFCKRLFSRLEPMTSWSHGSNFISYVKVP 160 SIVRSL LHFCKRLF LEP+TSWS G+NF + ++P Sbjct: 73 SIVRSLPLHFCKRLFPGLEPVTSWSQGNNFTAAPRLP 109