BLASTX nr result
ID: Atropa21_contig00029595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00029595 (452 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABY84674.1| fertilization-independent endosperm protein [Nico... 57 2e-06 ref|XP_006475218.1| PREDICTED: polycomb group protein FERTILIZAT... 57 2e-06 ref|XP_006452168.1| hypothetical protein CICLE_v10008697mg [Citr... 57 2e-06 ref|XP_006452167.1| hypothetical protein CICLE_v10008697mg [Citr... 57 2e-06 ref|XP_006452166.1| hypothetical protein CICLE_v10008697mg [Citr... 57 2e-06 ref|XP_002282472.1| PREDICTED: polycomb group protein FIE2 [Viti... 57 2e-06 ref|XP_002522836.1| fertilization-independent endosperm protein,... 56 4e-06 ref|NP_001234484.1| fertilization-independent endosperm protein ... 56 4e-06 gb|ABB16356.1| fertilization-independent endosperm protein [Sola... 56 4e-06 ref|NP_001274801.1| fertilization-independent endosperm protein ... 56 4e-06 ref|XP_002319805.1| polycomb group protein [Populus trichocarpa]... 56 6e-06 gb|EMJ12656.1| hypothetical protein PRUPE_ppa007346mg [Prunus pe... 55 7e-06 gb|ACG69840.1| fertilization-independent endosperm protein [Malu... 55 7e-06 gb|EPS69595.1| fertilization independent endosperm development p... 55 9e-06 ref|XP_004151960.1| PREDICTED: polycomb group protein FIE2-like ... 55 9e-06 gb|AAN85567.1| fertilization independent endosperm development p... 55 9e-06 gb|AFV15391.1| fertilization independent endosperm 1 protein [Ni... 55 9e-06 >gb|ABY84674.1| fertilization-independent endosperm protein [Nicotiana tabacum] Length = 370 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F IFIASVH+NYVDCNRWLGDFILS Sbjct: 226 TKYVQFPIFIASVHSNYVDCNRWLGDFILS 255 >ref|XP_006475218.1| PREDICTED: polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM-like isoform X1 [Citrus sinensis] Length = 369 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F +FIASVH+NYVDCNRWLGDFILS Sbjct: 226 TKYVQFPVFIASVHSNYVDCNRWLGDFILS 255 >ref|XP_006452168.1| hypothetical protein CICLE_v10008697mg [Citrus clementina] gi|567920326|ref|XP_006452169.1| hypothetical protein CICLE_v10008697mg [Citrus clementina] gi|557555394|gb|ESR65408.1| hypothetical protein CICLE_v10008697mg [Citrus clementina] gi|557555395|gb|ESR65409.1| hypothetical protein CICLE_v10008697mg [Citrus clementina] Length = 369 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F +FIASVH+NYVDCNRWLGDFILS Sbjct: 226 TKYVQFPVFIASVHSNYVDCNRWLGDFILS 255 >ref|XP_006452167.1| hypothetical protein CICLE_v10008697mg [Citrus clementina] gi|557555393|gb|ESR65407.1| hypothetical protein CICLE_v10008697mg [Citrus clementina] Length = 342 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F +FIASVH+NYVDCNRWLGDFILS Sbjct: 199 TKYVQFPVFIASVHSNYVDCNRWLGDFILS 228 >ref|XP_006452166.1| hypothetical protein CICLE_v10008697mg [Citrus clementina] gi|557555392|gb|ESR65406.1| hypothetical protein CICLE_v10008697mg [Citrus clementina] Length = 294 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F +FIASVH+NYVDCNRWLGDFILS Sbjct: 151 TKYVQFPVFIASVHSNYVDCNRWLGDFILS 180 >ref|XP_002282472.1| PREDICTED: polycomb group protein FIE2 [Vitis vinifera] gi|302143216|emb|CBI20511.3| unnamed protein product [Vitis vinifera] Length = 370 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F +FIASVH+NYVDCNRWLGDFILS Sbjct: 226 TKYVQFPVFIASVHSNYVDCNRWLGDFILS 255 >ref|XP_002522836.1| fertilization-independent endosperm protein, putative [Ricinus communis] gi|223537920|gb|EEF39534.1| fertilization-independent endosperm protein, putative [Ricinus communis] Length = 344 Score = 56.2 bits (134), Expect = 4e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F +FIAS+H+NYVDCNRWLGDF+LS Sbjct: 199 TKYVQFPVFIASIHSNYVDCNRWLGDFVLS 228 >ref|NP_001234484.1| fertilization-independent endosperm protein [Solanum lycopersicum] gi|166203415|gb|ABY84676.1| fertilization-independent endosperm protein [Solanum lycopersicum] Length = 372 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F + IASVHNNYVDCNRWLGDFILS Sbjct: 227 TKYVQFPLLIASVHNNYVDCNRWLGDFILS 256 >gb|ABB16356.1| fertilization-independent endosperm protein [Solanum commersonii] Length = 372 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F + IASVHNNYVDCNRWLGDFILS Sbjct: 227 TKYVQFPLLIASVHNNYVDCNRWLGDFILS 256 >ref|NP_001274801.1| fertilization-independent endosperm protein [Solanum tuberosum] gi|77997759|gb|ABB16357.1| fertilization-independent endosperm protein [Solanum tuberosum] Length = 372 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F + IASVHNNYVDCNRWLGDFILS Sbjct: 227 TKYVQFPLLIASVHNNYVDCNRWLGDFILS 256 >ref|XP_002319805.1| polycomb group protein [Populus trichocarpa] gi|566154790|ref|XP_006370617.1| FERTILIZATION-INDEPENDENT ENDOSPERM family protein [Populus trichocarpa] gi|550349823|gb|ERP67186.1| FERTILIZATION-INDEPENDENT ENDOSPERM family protein [Populus trichocarpa] Length = 371 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F +FIASVH+NYVDCNRWLGDF+LS Sbjct: 226 TKYVQFPVFIASVHSNYVDCNRWLGDFMLS 255 >gb|EMJ12656.1| hypothetical protein PRUPE_ppa007346mg [Prunus persica] Length = 371 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F +FIAS+H NYVDCNRWLGDF+LS Sbjct: 227 TKYVQFPVFIASIHTNYVDCNRWLGDFLLS 256 >gb|ACG69840.1| fertilization-independent endosperm protein [Malus domestica] Length = 371 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F +FIAS+H NYVDCNRWLGDF+LS Sbjct: 227 TKYVQFPVFIASIHTNYVDCNRWLGDFLLS 256 >gb|EPS69595.1| fertilization independent endosperm development protein [Genlisea aurea] Length = 370 Score = 55.1 bits (131), Expect = 9e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F +FIASVH NYVDCNRW+GDFILS Sbjct: 226 TKYVQFPMFIASVHTNYVDCNRWIGDFILS 255 >ref|XP_004151960.1| PREDICTED: polycomb group protein FIE2-like [Cucumis sativus] gi|449531818|ref|XP_004172882.1| PREDICTED: polycomb group protein FIE2-like [Cucumis sativus] Length = 370 Score = 55.1 bits (131), Expect = 9e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F +FIASVH+NYVDC+RWLGDFILS Sbjct: 226 TKYVQFPVFIASVHSNYVDCSRWLGDFILS 255 >gb|AAN85567.1| fertilization independent endosperm development protein [Catalpa speciosa] Length = 360 Score = 55.1 bits (131), Expect = 9e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F IFIASVH NYVDCNRW+GDF+LS Sbjct: 216 TKYVQFPIFIASVHTNYVDCNRWIGDFMLS 245 >gb|AFV15391.1| fertilization independent endosperm 1 protein [Nicotiana benthamiana] Length = 370 Score = 55.1 bits (131), Expect = 9e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 102 TSFLSFQIFIASVHNNYVDCNRWLGDFILS 191 T ++ F IFIASVH+NYVDC RWLGDFILS Sbjct: 226 TKYVQFPIFIASVHSNYVDCTRWLGDFILS 255