BLASTX nr result
ID: Atropa21_contig00029230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00029230 (802 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABH02929.1| MYB transcription factor MYB145 [Glycine max] 59 3e-06 ref|XP_006350902.1| PREDICTED: transcription factor MYB48-like [... 57 8e-06 ref|XP_004241250.1| PREDICTED: transcription factor MYB48-like [... 57 8e-06 >gb|ABH02929.1| MYB transcription factor MYB145 [Glycine max] Length = 259 Score = 58.5 bits (140), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 634 LILKCRWSKIAGKLPGRTDNEIKNYCRTHMR 726 L++ CRWS+IA KLPGRTDNEIKNY RTHMR Sbjct: 172 LMIPCRWSRIARKLPGRTDNEIKNYWRTHMR 202 >ref|XP_006350902.1| PREDICTED: transcription factor MYB48-like [Solanum tuberosum] Length = 258 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +1 Query: 649 RWSKIAGKLPGRTDNEIKNYCRTHMR 726 RWSKIAGKLPGRTDNEIKNY RTHMR Sbjct: 108 RWSKIAGKLPGRTDNEIKNYWRTHMR 133 >ref|XP_004241250.1| PREDICTED: transcription factor MYB48-like [Solanum lycopersicum] Length = 226 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +1 Query: 649 RWSKIAGKLPGRTDNEIKNYCRTHMR 726 RWSKIAGKLPGRTDNEIKNY RTHMR Sbjct: 82 RWSKIAGKLPGRTDNEIKNYWRTHMR 107