BLASTX nr result
ID: Atropa21_contig00029204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00029204 (570 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006341162.1| PREDICTED: gamma-tubulin complex component 3... 83 4e-14 ref|XP_004246563.1| PREDICTED: gamma-tubulin complex component 3... 83 6e-14 gb|EPS71643.1| hypothetical protein M569_03113 [Genlisea aurea] 65 2e-08 emb|CBI29999.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002275839.1| PREDICTED: gamma-tubulin complex component 3... 64 3e-08 ref|XP_002309295.2| hypothetical protein POPTR_0006s20870g [Popu... 62 1e-07 gb|EMJ04966.1| hypothetical protein PRUPE_ppa002938mg [Prunus pe... 62 1e-07 ref|XP_004161669.1| PREDICTED: LOW QUALITY PROTEIN: gamma-tubuli... 62 1e-07 ref|XP_004144694.1| PREDICTED: gamma-tubulin complex component 3... 62 1e-07 ref|XP_006429906.1| hypothetical protein CICLE_v10011052mg [Citr... 61 2e-07 ref|XP_004303346.1| PREDICTED: gamma-tubulin complex component 3... 61 2e-07 ref|XP_002532346.1| gamma-tubulin complex component, putative [R... 60 3e-07 gb|EOY09535.1| Spindle pole body component 98 isoform 1 [Theobro... 60 4e-07 ref|XP_002322735.1| SPINDLE POLE BODY COMPONENT 98 family protei... 59 7e-07 ref|XP_006604391.1| PREDICTED: gamma-tubulin complex component 3... 58 1e-06 ref|XP_003521223.1| PREDICTED: gamma-tubulin complex component 3... 58 1e-06 ref|XP_006492839.1| PREDICTED: gamma-tubulin complex component 3... 58 2e-06 gb|AEW07670.1| hypothetical protein 0_8522_01, partial [Pinus ra... 57 2e-06 gb|EXC30855.1| Gamma-tubulin complex component 3-like protein [M... 57 3e-06 ref|XP_006849550.1| hypothetical protein AMTR_s00024p00172850 [A... 57 4e-06 >ref|XP_006341162.1| PREDICTED: gamma-tubulin complex component 3 homolog [Solanum tuberosum] Length = 935 Score = 83.2 bits (204), Expect = 4e-14 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQPVTRGKLF 122 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQ+QP+TRGKLF Sbjct: 896 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQIQPITRGKLF 935 >ref|XP_004246563.1| PREDICTED: gamma-tubulin complex component 3-like [Solanum lycopersicum] Length = 875 Score = 82.8 bits (203), Expect = 6e-14 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQPVTRGKLF 122 EGFISQLPVQQH+DLKFLMFRLNFTEFYSQ+QP+TRGKLF Sbjct: 836 EGFISQLPVQQHVDLKFLMFRLNFTEFYSQIQPITRGKLF 875 >gb|EPS71643.1| hypothetical protein M569_03113 [Genlisea aurea] Length = 878 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQ 98 EGFISQLPVQQHIDLKFLMFRL+FTEFYSQL+ Sbjct: 843 EGFISQLPVQQHIDLKFLMFRLDFTEFYSQLR 874 >emb|CBI29999.3| unnamed protein product [Vitis vinifera] Length = 777 Score = 63.9 bits (154), Expect = 3e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQP 101 EGFISQLPVQQHIDLKFL+FRL+FTEFY QL P Sbjct: 743 EGFISQLPVQQHIDLKFLLFRLDFTEFYCQLHP 775 >ref|XP_002275839.1| PREDICTED: gamma-tubulin complex component 3 homolog [Vitis vinifera] Length = 854 Score = 63.9 bits (154), Expect = 3e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQP 101 EGFISQLPVQQHIDLKFL+FRL+FTEFY QL P Sbjct: 820 EGFISQLPVQQHIDLKFLLFRLDFTEFYCQLHP 852 >ref|XP_002309295.2| hypothetical protein POPTR_0006s20870g [Populus trichocarpa] gi|550336755|gb|EEE92818.2| hypothetical protein POPTR_0006s20870g [Populus trichocarpa] Length = 621 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQPVT 107 EGF+SQLPVQQH+DLKFL FRL+FTEFYS+ +P T Sbjct: 587 EGFLSQLPVQQHVDLKFLFFRLDFTEFYSRFRPGT 621 >gb|EMJ04966.1| hypothetical protein PRUPE_ppa002938mg [Prunus persica] Length = 620 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQPVT 107 E FIS+LP+QQH+DLKFL+FRL+FTEFYSQL+P T Sbjct: 586 EDFISKLPMQQHVDLKFLLFRLDFTEFYSQLRPST 620 >ref|XP_004161669.1| PREDICTED: LOW QUALITY PROTEIN: gamma-tubulin complex component 3-like [Cucumis sativus] Length = 846 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQP 101 E FISQLP+QQH+DLKFL+FRL+FTEFYSQL+P Sbjct: 812 EEFISQLPLQQHVDLKFLLFRLDFTEFYSQLRP 844 >ref|XP_004144694.1| PREDICTED: gamma-tubulin complex component 3-like [Cucumis sativus] Length = 846 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQP 101 E FISQLP+QQH+DLKFL+FRL+FTEFYSQL+P Sbjct: 812 EEFISQLPLQQHVDLKFLLFRLDFTEFYSQLRP 844 >ref|XP_006429906.1| hypothetical protein CICLE_v10011052mg [Citrus clementina] gi|557531963|gb|ESR43146.1| hypothetical protein CICLE_v10011052mg [Citrus clementina] Length = 853 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/33 (75%), Positives = 33/33 (100%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQP 101 EGF++QLPVQQH+DLKFL+FRL+FTEFY++L+P Sbjct: 819 EGFLAQLPVQQHVDLKFLLFRLDFTEFYTRLRP 851 >ref|XP_004303346.1| PREDICTED: gamma-tubulin complex component 3-like [Fragaria vesca subsp. vesca] Length = 851 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQPVT 107 E FIS+LP+QQH+DLKFL+FRL+FTEFYSQL P T Sbjct: 817 EDFISKLPMQQHVDLKFLLFRLDFTEFYSQLHPST 851 >ref|XP_002532346.1| gamma-tubulin complex component, putative [Ricinus communis] gi|223527963|gb|EEF30048.1| gamma-tubulin complex component, putative [Ricinus communis] Length = 855 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQP 101 +GF+SQLPVQQH+DLKFL+FRL+FTEFYS+L P Sbjct: 821 KGFLSQLPVQQHVDLKFLLFRLDFTEFYSRLCP 853 >gb|EOY09535.1| Spindle pole body component 98 isoform 1 [Theobroma cacao] Length = 852 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQP 101 EGF++QLPVQQHIDLKFL+FRL+FTEFYS+ P Sbjct: 818 EGFLAQLPVQQHIDLKFLLFRLDFTEFYSRQHP 850 >ref|XP_002322735.1| SPINDLE POLE BODY COMPONENT 98 family protein [Populus trichocarpa] gi|222867365|gb|EEF04496.1| SPINDLE POLE BODY COMPONENT 98 family protein [Populus trichocarpa] Length = 844 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQP 101 EGF+SQLP+QQH+DLKFL FRL+F EFYS+L P Sbjct: 810 EGFLSQLPMQQHVDLKFLFFRLDFAEFYSRLHP 842 >ref|XP_006604391.1| PREDICTED: gamma-tubulin complex component 3-like isoform X1 [Glycine max] gi|571557350|ref|XP_006604392.1| PREDICTED: gamma-tubulin complex component 3-like isoform X2 [Glycine max] gi|571557353|ref|XP_006604393.1| PREDICTED: gamma-tubulin complex component 3-like isoform X3 [Glycine max] gi|571557356|ref|XP_006604394.1| PREDICTED: gamma-tubulin complex component 3-like isoform X4 [Glycine max] gi|571557359|ref|XP_006604395.1| PREDICTED: gamma-tubulin complex component 3-like isoform X5 [Glycine max] Length = 842 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQP 101 EGFISQLPVQQH+DLKFL FRL+F EFY +L P Sbjct: 808 EGFISQLPVQQHVDLKFLFFRLDFNEFYRRLCP 840 >ref|XP_003521223.1| PREDICTED: gamma-tubulin complex component 3-like isoform X1 [Glycine max] Length = 844 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQP 101 EGFISQLPVQQH+DLKFL FRL+F EFY +L P Sbjct: 810 EGFISQLPVQQHVDLKFLFFRLDFNEFYRRLCP 842 >ref|XP_006492839.1| PREDICTED: gamma-tubulin complex component 3 homolog [Citrus sinensis] Length = 853 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/33 (72%), Positives = 32/33 (96%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQP 101 E F++QLPVQQH+DLKFL+FRL+FTEFY++L+P Sbjct: 819 EVFLAQLPVQQHVDLKFLLFRLDFTEFYTRLRP 851 >gb|AEW07670.1| hypothetical protein 0_8522_01, partial [Pinus radiata] gi|383158857|gb|AFG61816.1| hypothetical protein 0_8522_01, partial [Pinus taeda] gi|383158859|gb|AFG61817.1| hypothetical protein 0_8522_01, partial [Pinus taeda] gi|383158861|gb|AFG61818.1| hypothetical protein 0_8522_01, partial [Pinus taeda] gi|383158863|gb|AFG61819.1| hypothetical protein 0_8522_01, partial [Pinus taeda] gi|383158865|gb|AFG61820.1| hypothetical protein 0_8522_01, partial [Pinus taeda] gi|383158867|gb|AFG61821.1| hypothetical protein 0_8522_01, partial [Pinus taeda] gi|383158869|gb|AFG61822.1| hypothetical protein 0_8522_01, partial [Pinus taeda] gi|383158871|gb|AFG61823.1| hypothetical protein 0_8522_01, partial [Pinus taeda] gi|383158873|gb|AFG61824.1| hypothetical protein 0_8522_01, partial [Pinus taeda] gi|383158875|gb|AFG61825.1| hypothetical protein 0_8522_01, partial [Pinus taeda] gi|383158877|gb|AFG61826.1| hypothetical protein 0_8522_01, partial [Pinus taeda] gi|383158879|gb|AFG61827.1| hypothetical protein 0_8522_01, partial [Pinus taeda] gi|383158881|gb|AFG61828.1| hypothetical protein 0_8522_01, partial [Pinus taeda] gi|383158883|gb|AFG61829.1| hypothetical protein 0_8522_01, partial [Pinus taeda] Length = 72 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQ 92 EGFI+QLP+QQH+DLKFL+FRL+FTEFYS+ Sbjct: 17 EGFIAQLPLQQHVDLKFLLFRLDFTEFYSK 46 >gb|EXC30855.1| Gamma-tubulin complex component 3-like protein [Morus notabilis] Length = 856 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQP 101 E FISQLP QQH+DLKFL+FRL+FTEFYS+ P Sbjct: 822 ENFISQLPEQQHVDLKFLLFRLDFTEFYSRQHP 854 >ref|XP_006849550.1| hypothetical protein AMTR_s00024p00172850 [Amborella trichopoda] gi|548853125|gb|ERN11131.1| hypothetical protein AMTR_s00024p00172850 [Amborella trichopoda] Length = 471 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 3 EGFISQLPVQQHIDLKFLMFRLNFTEFYSQLQ 98 +GFI+QLPVQQH+DLKFL FRL+FTEFY++ Q Sbjct: 428 DGFIAQLPVQQHVDLKFLFFRLDFTEFYTRQQ 459