BLASTX nr result
ID: Atropa21_contig00029178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00029178 (530 letters) Database: nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006356802.1| PREDICTED: KH domain-containing protein At4g... 62 8e-08 ref|XP_004238048.1| PREDICTED: KH domain-containing protein At4g... 60 2e-07 ref|XP_006472368.1| PREDICTED: KH domain-containing protein At4g... 58 2e-06 ref|XP_006433702.1| hypothetical protein CICLE_v10000476mg [Citr... 58 2e-06 gb|EMJ26871.1| hypothetical protein PRUPE_ppa002274mg [Prunus pe... 57 3e-06 gb|EXC01140.1| KH domain-containing protein [Morus notabilis] 57 3e-06 gb|EOY15603.1| RNA-binding KH domain-containing protein, putativ... 55 8e-06 gb|EOY15601.1| RNA-binding KH domain-containing protein, putativ... 55 8e-06 emb|CBI19333.3| unnamed protein product [Vitis vinifera] 55 1e-05 ref|XP_002283591.1| PREDICTED: KH domain-containing protein At4g... 55 1e-05 >ref|XP_006356802.1| PREDICTED: KH domain-containing protein At4g18375-like [Solanum tuberosum] Length = 675 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 529 GATETVIIISGTPEQTNAAQSLIQAFVMVETD 434 GATETVIIISGTPEQTNAAQSLIQAFVMVET+ Sbjct: 642 GATETVIIISGTPEQTNAAQSLIQAFVMVETE 673 >ref|XP_004238048.1| PREDICTED: KH domain-containing protein At4g18375-like [Solanum lycopersicum] Length = 671 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 529 GATETVIIISGTPEQTNAAQSLIQAFVMVETD 434 GATE+VIIISGTPEQTNAAQSLIQAFVMVET+ Sbjct: 638 GATESVIIISGTPEQTNAAQSLIQAFVMVETE 669 >ref|XP_006472368.1| PREDICTED: KH domain-containing protein At4g18375-like isoform X1 [Citrus sinensis] gi|568836690|ref|XP_006472369.1| PREDICTED: KH domain-containing protein At4g18375-like isoform X2 [Citrus sinensis] gi|568836692|ref|XP_006472370.1| PREDICTED: KH domain-containing protein At4g18375-like isoform X3 [Citrus sinensis] Length = 696 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 529 GATETVIIISGTPEQTNAAQSLIQAFVMVETD 434 GATETVIIISGTPEQT+AAQSLIQAFVM ET+ Sbjct: 663 GATETVIIISGTPEQTHAAQSLIQAFVMSETE 694 >ref|XP_006433702.1| hypothetical protein CICLE_v10000476mg [Citrus clementina] gi|567882289|ref|XP_006433703.1| hypothetical protein CICLE_v10000476mg [Citrus clementina] gi|567882291|ref|XP_006433704.1| hypothetical protein CICLE_v10000476mg [Citrus clementina] gi|567882293|ref|XP_006433705.1| hypothetical protein CICLE_v10000476mg [Citrus clementina] gi|557535824|gb|ESR46942.1| hypothetical protein CICLE_v10000476mg [Citrus clementina] gi|557535825|gb|ESR46943.1| hypothetical protein CICLE_v10000476mg [Citrus clementina] gi|557535826|gb|ESR46944.1| hypothetical protein CICLE_v10000476mg [Citrus clementina] gi|557535827|gb|ESR46945.1| hypothetical protein CICLE_v10000476mg [Citrus clementina] Length = 693 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 529 GATETVIIISGTPEQTNAAQSLIQAFVMVETD 434 GATETVIIISGTPEQT+AAQSLIQAFVM ET+ Sbjct: 660 GATETVIIISGTPEQTHAAQSLIQAFVMSETE 691 >gb|EMJ26871.1| hypothetical protein PRUPE_ppa002274mg [Prunus persica] Length = 693 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 529 GATETVIIISGTPEQTNAAQSLIQAFVMVETD 434 GA ETVIIISGTPEQT+AAQSLIQAFVM ETD Sbjct: 660 GALETVIIISGTPEQTHAAQSLIQAFVMSETD 691 >gb|EXC01140.1| KH domain-containing protein [Morus notabilis] Length = 675 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 529 GATETVIIISGTPEQTNAAQSLIQAFVMVETD 434 GA ETVIII+GTPEQTNAAQSLIQAFVM ET+ Sbjct: 642 GAVETVIIIAGTPEQTNAAQSLIQAFVMSETE 673 >gb|EOY15603.1| RNA-binding KH domain-containing protein, putative isoform 3 [Theobroma cacao] Length = 662 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 526 ATETVIIISGTPEQTNAAQSLIQAFVMVETD 434 ATETVIIISGTPEQT+AAQSLIQAFVM ET+ Sbjct: 630 ATETVIIISGTPEQTHAAQSLIQAFVMSETE 660 >gb|EOY15601.1| RNA-binding KH domain-containing protein, putative isoform 1 [Theobroma cacao] gi|508723705|gb|EOY15602.1| RNA-binding KH domain-containing protein, putative isoform 1 [Theobroma cacao] Length = 674 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 526 ATETVIIISGTPEQTNAAQSLIQAFVMVETD 434 ATETVIIISGTPEQT+AAQSLIQAFVM ET+ Sbjct: 642 ATETVIIISGTPEQTHAAQSLIQAFVMSETE 672 >emb|CBI19333.3| unnamed protein product [Vitis vinifera] Length = 672 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 529 GATETVIIISGTPEQTNAAQSLIQAFVMVETD 434 GA+ETVIIISGTPEQT+AAQSLIQAFV+ ET+ Sbjct: 639 GASETVIIISGTPEQTHAAQSLIQAFVLSETE 670 >ref|XP_002283591.1| PREDICTED: KH domain-containing protein At4g18375-like [Vitis vinifera] Length = 701 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 529 GATETVIIISGTPEQTNAAQSLIQAFVMVETD 434 GA+ETVIIISGTPEQT+AAQSLIQAFV+ ET+ Sbjct: 668 GASETVIIISGTPEQTHAAQSLIQAFVLSETE 699