BLASTX nr result
ID: Atropa21_contig00028285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00028285 (578 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004246538.1| PREDICTED: uncharacterized protein LOC101261... 57 5e-06 >ref|XP_004246538.1| PREDICTED: uncharacterized protein LOC101261444 [Solanum lycopersicum] Length = 357 Score = 56.6 bits (135), Expect = 5e-06 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -1 Query: 128 GFSCDRDIIVDAYFLWLQEVMQSLGIYIVSIDRPGYGESDPH 3 GF C R +V A L Q+V++SLGIYIVSIDRPGYGESDPH Sbjct: 80 GFDCCRHDVVIASTL-SQDVIESLGIYIVSIDRPGYGESDPH 120