BLASTX nr result
ID: Atropa21_contig00028105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00028105 (617 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 66 7e-09 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477403|gb|AES58606.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 66.2 bits (160), Expect = 7e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -1 Query: 269 FRFVRDRFTPGGAYTSRLSKFCSKISSENLYREGSISRGAAVLP 138 FR VRDRFTP GAYTSRLSKFCSK S ENLYREG AVLP Sbjct: 359 FRLVRDRFTPRGAYTSRLSKFCSKTSFENLYREGFPGWLLAVLP 402