BLASTX nr result
ID: Atropa21_contig00028100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00028100 (884 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173498.1| hypothetical protein NitaMp161 [Nicotiana tabac... 63 1e-07 >ref|YP_173498.1| hypothetical protein NitaMp161 [Nicotiana tabacum] gi|56806663|dbj|BAD83564.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 134 Score = 63.2 bits (152), Expect = 1e-07 Identities = 33/48 (68%), Positives = 38/48 (79%), Gaps = 3/48 (6%) Frame = +1 Query: 331 NRMKDSFQDHMLLNQLLLPGKVLSFPCSPWVW-LKK--PWMDQN*CKG 465 +RMK SFQDH+LLNQLLLPG++LSFPCSP + L K PWMD N KG Sbjct: 87 HRMKGSFQDHLLLNQLLLPGEILSFPCSPRDFTLGKLIPWMDHNLYKG 134